SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|74682|estExt_fgeneshPB_pm.C_70025 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|74682|estExt_fgeneshPB_pm.C_70025
Domain Number 1 Region: 317-392
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000109
Family PCI domain (PINT motif) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|74682|estExt_fgeneshPB_pm.C_70025
Sequence length 434
Sequence
MMAAAHDLTLRMIPFLDRHLVFPLIEFLELNKVYPAEDLLKAKYDLFNNSNMVDFVLDLY
KKIHNTEDTPQEFVDKREVVLNRLEELQGEVQEVMTILEKPEVIAALRSDKAQNLNYLKE
NYNLTENRINILYEFGQFQFSCGDYGGAADMLYHFRVLSTDTERAFSASWGKLAAEILTG
NWEAALEEMQNMREAIDQKSFSSPLHQLQQRSWLIHWSLFVFFNHPKGRDGIVDMFLSPQ
YINTIQTSCPWILRYLATAVVTNKRRKNQMKELVRIIEQEAYEYKDPVTEFIEALFIHFD
FEGAQKKLKECEDVLSNDFFLAATQEDFMESARQFISETYCRIHQKINIKDMSQTLNLNQ
EEGEKWIVNLIRDTRVDAKIDFEENTVIMNTPVTSIYQQVIERTKGLSFRSQVLASAVKK
RAEAQTQAAVESAH
Download sequence
Identical sequences jgi|Phybl1|74682|estExt_fgeneshPB_pm.C_70025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]