SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|75040|estExt_fgeneshPB_pm.C_200027 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|75040|estExt_fgeneshPB_pm.C_200027
Domain Number 1 Region: 1867-2041
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.7e-53
Family Sec63 N-terminal domain 0.000000888
Further Details:      
 
Domain Number 2 Region: 1034-1207
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.54e-52
Family Sec63 N-terminal domain 0.00061
Further Details:      
 
Domain Number 3 Region: 1238-1531
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-48
Family Tandem AAA-ATPase domain 0.00069
Further Details:      
 
Domain Number 4 Region: 698-913
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.82e-47
Family Tandem AAA-ATPase domain 0.00087
Further Details:      
 
Domain Number 5 Region: 446-688
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-41
Family Tandem AAA-ATPase domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1540-1749
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.14e-40
Family Tandem AAA-ATPase domain 0.0029
Further Details:      
 
Domain Number 7 Region: 2043-2157
Classification Level Classification E-value
Superfamily E set domains 8.4e-30
Family Sec63 C-terminal domain-like 0.00002
Further Details:      
 
Domain Number 8 Region: 913-1018
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000299
Family RecQ helicase DNA-binding domain-like 0.096
Further Details:      
 
Domain Number 9 Region: 1749-1847
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000326
Family CAP C-terminal domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|75040|estExt_fgeneshPB_pm.C_200027
Sequence length 2173
Sequence
MAENIAKANQYQYAANSSLVLQADRKGLPRRDQEPTGEPETLWGRIDPKGFGARVERETP
KDIEEKKKKAAERAEESAEKKRRKKEENAISKAYGYSSVLSATEDWEGLNYKPRTKETRE
AYEHILSFVYEHLGDQARDVIRSAADDVLETLKTDTLKDFDKKREIESVIGPIQSERFAQ
LVNLSKKITDYSAEGDAMDVDENGEKLGEIDDELGVAVVFDDEDDEEEEDDQYEVKEDDE
EEEDTSMAATLSSGREIVEEEEEEEDAEDGFKTVLPGAESGRKKKRGTAKQLTDHVSPHD
IDAFWLQRQVATYYTDPYTAQDKTTKAFDILGSEEINIRDCENELMGLFDYDKFDLVRIL
IKNRDLIYWCTRLARLDGPEKAALERELENKGLSWILRELSGDRQRRGEALVPTTTTLTP
GTTVAPRQMLDLEALAFEQGAHLMSNKKVKLPDGSFKRSKKGYEEIHVPAPKPQSFGADE
KLVPIKSMPSWTHDAFAGAENLNRVQSRLYPTAFGSDENVLLCAPTGAGKTNVAMLTILH
EIGKNRDPETGLIDLDSFKIVYIAPMKALVAEMVGNFSKRLRPYGVQVAELTGDRQLTKQ
QIAETQIIVTTPEKWDVITRKATDRSYTTLVRLIIIDEIHLLHDDRGPVLESIVSRTIRN
MEQTQELVRLVGLSATLPNYADVAAFLRVDAKSGLFFFDSTFRPCPLKQQFIGVTEKKAI
KRFQVMNEVCYEKVIEQIEQREENQVLVFVHSRKETAKTAKTLRDLALEKDTIGRFLKQD
SASREILQSEAATVKDANLQDLLPYGFAIHHAGMTRADRTLVEELFADGHIKVLCSTATL
AWGVNLPAHAVIIKGTQIYSPEKGRWVELSPQDVLQMLGRAGRPQFDTYGEGIIITAHAE
LQYYLSLLNTQLPIESQFISRLADNLNAEIVLGTIRNRDEAVQWLGYTYLYVRMLRNPSL
YNVSADDLSDDPYLEQKRVDLIHSAAAVLDKCNLIKYDKKSGRFQVTELGRIASHFYVTH
HSMATYNQHLKPMMSHIELFRVFALSDEFKYIPVREEEKLELSKLLERVPIPVKESLEEP
TAKINVLLQSYISQLKLDGFALVSDMVYVTQSAGRILRAIFEICLKRGWAQLTKKALDLC
KMVEKRSWLSMSPLRQFKAMPSDLIKRLERKEFPWERYFDLNPQELGELVGQPKAGRQLH
KFIHQFPRLDIQAHVQPVTRSLLKMELTITPDFQWDEKVHGTAEAFWILVEDVDGETILH
HDYFILKQRYATEDHLVSFTVPLYEPLPPNYFVTVVADRWLHAETKLPVSFKHLILPEKY
APHTELHDLQPLPVSALRNPAYENVYSRWIKQFNPIQTQAFNALYTTDDNAFIGAPTGSG
KTVCAEFAILRMWNQQSKGRCVYVAPFQEIVDQRVVDWQEKFGKLDGGKEIVALTGETSA
DLKLLERGDIIACTPTQWDIVSRRWKQRKNVQNVNLFIADELHLIGGDIGPTYEVIVSRM
RYIASQTQKTIRIVALSTSLANAKDLGEWIGAPSQAIFNFHPSVRPVPLEIHIQSYNIPH
FASLMMAMAKPTYLAITTHSAEKPVIVFVPSRKQCRLTAVDIITYCIGDDTPDRFLHCKI
EEIKPFLDRVQDKNLAETLEHGIGFYHEALSKQDKLIVEQLYTNKAIQVVVASRDTCWGL
PLNSHMVIVMGTQYFEGKDHRYADYPITDVLQMMGRACRPREDDTGKCVLMCQANKKEFY
KKFLYEALPVESHLDQFIHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMAHNPNYYGLQ
GTSHRHLSDHLSELVENTLNELQETKCITVEDEMDVSPLNLGMIAAYYNINYGTIDMFSV
SLKSATKLKGLLEIVSAATEFEGIPIRHHEDAVLKRLYERLPVKLTSPDFNAPRFKTNIL
LQAHFSRMQLPPDLQSDQAMVLGRIIPLLQACVDVISSNGWLSPALASMELSQMSVQAMW
DRDSPLKQVPYFTNEVIKRCEANQVESVFDIMELEDDVRNDVLRMDPSKLREVARFVNRY
PNIELGFDVGDADSISSGNVVNVKVQLERESEDNEEIGPVVAPFFPQKKDEGWWIVIGDP
EQKVLLAIKRVTLQQKLTVKLDFIAPKAGHHNLKVYLMSDSYNGCDQELDMELDVAEGED
SDEEMSEEESDAE
Download sequence
Identical sequences jgi|Phybl1|75040|estExt_fgeneshPB_pm.C_200027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]