SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|75430|estExt_fgeneshPB_pg.C_10082 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|75430|estExt_fgeneshPB_pg.C_10082
Domain Number 1 Region: 382-604
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-51
Family DBL homology domain (DH-domain) 0.0000788
Further Details:      
 
Domain Number 2 Region: 614-678,718-767
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000219
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 3 Region: 197-275
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000196
Family DEP domain 0.046
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|75430|estExt_fgeneshPB_pg.C_10082
Domain Number - Region: 780-846,940-992
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.085
Family SGL-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|75430|estExt_fgeneshPB_pg.C_10082
Sequence length 1151
Sequence
MSYPDVKQSTFNDLNMANGLFGTLPQKTAPIIPDHCVDNTRLVPSSSHSNAQKIDWEHAY
TKDMLEKAAKNECSLLNMSMTDGKCRLSGPRPSMTLWDERPYDGLDLPQKSSISSKEESK
VFFRSKEPEFVPEVQNRNKGKMQPSSQNISHQPHRITFTNSQACETNRIHRMHDTVRPPP
INTSAIVYGALISVVAQEFQQRIIQGDRVKNGIEYKNAFDGKEAVDKLALILNTTDRRLA
LGIGRALGAQRFFHDVNYESRLVDSTLEIYQFDDYVLHYANKTDGHISGNGSVITSPGTM
TTASSIFSESLRDDESVTIFHDAQMDLETTEFPTGVFTGLTHCFVPTCDLNQTNNNRHYS
VDTPLTISTTHKYLQTEAQQLWTDNVSPDIRASVSNSERKRQETIFELIYTEENFSSDLD
YMNELWIEPLRDGNVIPASRRDTFIDKVFSNLLSIRNISRKLVNVLLERQNEYPIVSQIG
DIMLKFAVDFEPFIYYGARQHEAKFVFEQERYINPALRIFAETTERNPSSKKLELNGYLT
KPTTRLGRYTLLLNEILKHTPEGHPDRIQIPNAVDTIRQFLGRVNVETGKAKNKFDLERI
HKHLTFKNKADAMDLKLLEEDRHIIKQGVLRKTSNLESTEYQAILLDNYLVISKIKIVHG
RECHIVRKRPIPLELLEVSVPQSCALTHRSGSILSYIPTVESQRSSAVIGSLRLAGNTSI
TASRIGHPIVFKRMGRRMSETFTLYAPSVATRKPWLEHIQSQREIKNQRQPVFDIHPIIP
ERTFYVNSKINHIVTFKNGQFYVLATDNGVYLGRVVSQSPPRQVLNLERVTQVNVLESDK
LLMVLADKVLWEYPLAVLSDTSKVQLPGLKLETQVPFFHVGYCLDKTLICVPQVSPLSTT
ITLYEPSSSPEKKSGSFLGIFGKTKKVSVKTRLRIFRKTYVPSEAWALELTPNNLLITCK
RGIVIVDMHTNKIDCEFRSPVFNIFSFVSGTDYNPHALDLLDPNDKNLNFITSREKDESR
LNIGIDVKHISLFCNHLKEYIVCYDEYAFYIDKKGRRKYPNFLIEWEGTPDTFAYSYPYL
IAFEPSFIEIRNIITGNLEQIIRGKNFLCLSNGHKTEVPFIFGVMTDPVKDAYHSIFQLK
LVSEDKTPPLL
Download sequence
Identical sequences A0A167Q6V9
jgi|Phybl1|75430|estExt_fgeneshPB_pg.C_10082 XP_018297216.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]