SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|76072|estExt_fgeneshPB_pg.C_20572 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|76072|estExt_fgeneshPB_pg.C_20572
Domain Number 1 Region: 209-292
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-35
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|76072|estExt_fgeneshPB_pg.C_20572
Sequence length 769
Sequence
MTDLQSPSNGFNGIEWVDRSSNPVSYPQSYTSSYGSGNSTILPTNGPEAINRIQTFYRQL
PPINAEGSSSGNNLSLQTSSHQTDPKGATATPPSASTRLDTEETESKKQILSTYSNSTNT
NTNTNTNTNTTTNSNSNTMSNASWVQTTGRTSKETDIPQSSDLMSFNTPNQCQPTPSPTA
SSGQGSPLKKTRTASTAKELRVERNTEGKPPYSYATLIKYAIENSSDRKLTLSDIYQWVI
DHYPYYNSAGSGWKNSIRHNLSLNKSFVRVPRPINEPGKGSYWTVDYHITDSERRPRHAS
MSRVRGNRSGSDPSPSPYRPEIWLGHTRHFRDGRSLSADATTSHAISSTSISSYNNTTPC
TCGRHTGPHVPYHHHYHHHPLPHARSSMQIMSRSQSNPYMQSGLANSHYGHQSGEVATTT
TTNNTTTSGSTAAAAAAATVAATATATLPVHNYNVYGVEGIQNQHNHSYYNSNTYTQQQQ
QHASHSHHSHLSRSNLSLATIGSTGSSSYSAPTSSYDKTVYPNYQTNVCEETSILGNPKS
LTGYQYSSTVARVPHPPSLGSRLSTWQQVKTETPASAGQSPSPSISSPVPTQSINPVTQE
DVVISNCNSSQTAPENQMNIENQVPNSSYRKLASPNTSSSSSSYLPYETSQEHQHHQHHQ
QMASNTSSPGYGLRSPEPNTMISNPSNPSFCYESHGSNSQISSASASASAAVGASASSAS
SSISASARSISGRKRPNRNPSSTLHHTHTIPVGSPAMNHKESFEWDVSL
Download sequence
Identical sequences jgi|Phybl1|76072|estExt_fgeneshPB_pg.C_20572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]