SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|76487|estExt_fgeneshPB_pg.C_30473 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|76487|estExt_fgeneshPB_pg.C_30473
Domain Number 1 Region: 342-364,392-641
Classification Level Classification E-value
Superfamily Cullin homology domain 9.02e-77
Family Cullin homology domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 1-337
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.62e-64
Family Cullin repeat 0.000033
Further Details:      
 
Domain Number 3 Region: 646-731
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-25
Family SCF ubiquitin ligase complex WHB domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|76487|estExt_fgeneshPB_pg.C_30473
Sequence length 731
Sequence
MCNAIPQPFTEKVFTGIAEYIDKHTVELCQNILKHDDLVTAYARPFERFKLAAEDTSAGC
NYLNGIITAAYSTGSRDRKPSVAGGKYKKQSVESLAMSLWKTNVLFTIRDRHQNRLLYQV
FELIRRDRDGVDAPYGTIKGVVTSLVQAHSFTGQPLQLYIEEFERPYLVHTKRYYEAEAA
REIASGSVSSFMKKASERLEQEIKRNNQYCHSTSHSRIVKEFEAQYITAYQDRIIDEFEN
MLRDERYEDCTRAYNLLSRIPDGLKPILTIYEEYISKIGKDMVSKLNSSALKNPRLYVDQ
LLILHGKFHQVNQQVFLADPLFTAAGDKAFRTIINDPNGATSSNGSETLARYCDMMLKKN
AGKKEAGVTASTTNSLDGKKKGALKKPVQDIEDGDPEEKLAKMITLFKYVDDKDVFQKFY
SRMLAKRLIYSASASEEMEANMINCLKEICGVEYTSKLNKMFTDMSLSSDLNVNFKDYLK
QQSCKMNVGFDILVLTQGAWPLNQKEDPNEADINKVQIPSELEENVTLFEDFYGKHHNGR
RLLWQWNLARGEMRLNYLDRHYELQVGLYQIVILLLFNSVTEMSIADLLVHSGLSLPDTL
RSIKPLVDIHILESNASSLNKSSVVKINMKFSSKRTKIKVSAAGAQAEAQQESQATRKAV
EEDRRMYIQAAVVRIMKSRQRLSHVQLIQEIIDQANSRFSPSVIMIKKCIEQLLEKQFIA
RQGRDTYVYVA
Download sequence
Identical sequences jgi|Phybl1|76487|estExt_fgeneshPB_pg.C_30473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]