SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|76704|estExt_fgeneshPB_pg.C_40164 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|76704|estExt_fgeneshPB_pg.C_40164
Domain Number 1 Region: 57-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.72e-21
Family La domain 0.0013
Further Details:      
 
Domain Number 2 Region: 145-247
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000814
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|76704|estExt_fgeneshPB_pg.C_40164
Sequence length 364
Sequence
MSAVQENAVPSVQENTAAPVQETTVAPVQETTEAPAQEVTEAPAQEVTEAPAQEKPVTSI
NDKIRKQFNFYFGDSNLPYDKYLWTLTGSTGTGWVPIEKVASFKKMQTICDDLNTIIAAL
KEVPSDLLEIDEEAKNIRRKTTPVEVNHEIRSIYVNNLPLVDAGIDDRSIAAENMIALQN
ELEELFETVGEVLALRFKKFHNKMKGSAIVEFATPELSEKAAAKEWEFRGTKLFVQTSTQ
HAELKKNKPVNKPFNKHYKKHYEFNAFRPAPPRPTHNNKRKGDHEHKKQNKFAKKEQTVK
ETVDEEMPTAAPVAEAPVAPVAEAPAAPAETEAAPAAEVPAPAPAAVEEKAQPEEAKPVE
EKAE
Download sequence
Identical sequences A0A167QXW9
XP_018298481.1.77709 jgi|Phybl1|76704|estExt_fgeneshPB_pg.C_40164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]