SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|76859|estExt_fgeneshPB_pg.C_40533 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|76859|estExt_fgeneshPB_pg.C_40533
Domain Number 1 Region: 98-191
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000311
Family FHA domain 0.0041
Further Details:      
 
Domain Number 2 Region: 392-470
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000635
Family Forkhead DNA-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|76859|estExt_fgeneshPB_pg.C_40533
Sequence length 553
Sequence
MTTCDGKHMNKMDEKMTMMMTTTTTTATATAATTMMMMTDRAPETPPSNWNIKRITPFTQ
PSDMPDSPDRQDSDLYYLNSDDLVQTSDVGYSPADHTPRALVIVGSREKTITLGRGGAST
VKIGRRNRQISRIHVSIEHNPTKDSFELVVLGLNGATVDNVLYGQHERAELSQDSMIDVL
GDIILFKEPPPLCEAGDEEEVMEEEEHMYEEEEEVAEDQEHEHIHEHVHEHEYEYNHDNK
HELEHEEEEEDEVVENEDLFGDHLELSSMMEGSEMDKLEELEDLSMLSAVYHDDEDEEIL
ERQKGQEMVEYEEEEDQEDEKPVNQKISRKFLIEEDEDEDEEDEEKNVVQNTRRQRQRPR
QEEDEESDDDEEAEVKAEEDKKEEKQCVEKETDYSEIIIDALVFSRKSSMPMSDICSRIM
KTNPTYRQQPRELWMSRIQHVLQICPFFGEIVRKGKTADGSPKENLYYYSSDKDPVEWRR
TAYTQVGRSARKCTLQDKQYFWRIPPKLGRHRGTYIPPPAKDYYEPNNTSKRTNKSEEAE
ENSRKKSKHNSTN
Download sequence
Identical sequences jgi|Phybl1|76859|estExt_fgeneshPB_pg.C_40533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]