SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|78971|estExt_fgeneshPB_pg.C_200216 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|78971|estExt_fgeneshPB_pg.C_200216
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-17
Family PCI domain (PINT motif) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|78971|estExt_fgeneshPB_pg.C_200216
Sequence length 446
Sequence
MADGKLEKMEKDYSPQVDVLIPETEALVKQGKLSVALEKILLLEKQARNAADQASTGRLL
VQAVKLCHQAGDWKALNEQIILLSKKHGQLKAATTKMVQEAMSYLDTTPNKEAKLELIDT
LRTVTDGKIYVEVERARVTRMLSKIREDEGKTTEAADILQELQVETFGSMDKREKVDFIL
EQMRLCLAKHDYVRTQIISKKINTKFFLEKENEDLKLRYYDLMIQHALHEGQHLNVHKFY
KQIYDSESIKLDDNKWKEALQQAILFIILSPYDNEQSDLLHRIYQDPKTADLPIYSELVK
LFVTDELMRWPMIEDKYGELLGKTSVFKKSAEDGQKRWKELHHRVIEHNIRVIAKYYTRV
STKRLGQLLDLNEKDAEESLSKLVVSKTIYARIDRMAGIVSFQVKKDANQTLNDWSSDIN
SLLNLVEKTCHLISKEEMVHSIAKVM
Download sequence
Identical sequences A0A167N6Y4
jgi|Phybl1|78971|estExt_fgeneshPB_pg.C_200216 XP_018293220.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]