SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79068|estExt_fgeneshPB_pg.C_220020 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79068|estExt_fgeneshPB_pg.C_220020
Domain Number 1 Region: 441-567
Classification Level Classification E-value
Superfamily CheY-like 1.85e-34
Family CheY-related 0.0028
Further Details:      
 
Domain Number 2 Region: 19-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-28
Family Heat-shock transcription factor 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79068|estExt_fgeneshPB_pg.C_220020
Sequence length 766
Sequence
MIKKPTAPHVKSNEGAGVVPDFIQKLFRMLENKSFNDTFCWGPDGTTFLVKDINDFSRTI
LPKHFKHCNFASFVRQLNKYDFHKVRNPEDGHRMYADQVWVHPKFRRDRKDLLEEIRRKS
PGKPKKDKPVLTGDADVQPLATTSTDQEPSHQSSIDSLLELTRHLQAQVDGLRKSQTDME
LQMQKMNRADQQIADELVQFNKSMAAKDNLLQQFVKIDTENNQAQSTQRQTQSQNHHTST
IINMSSVENNNQQIYDTSTTSTPTPTTNYQDNTISPKLDQSKKRKDCGGACETNEDIWLQ
QQQQQQQQQQGQNSIPSSETTAQFREIQAIPFVHLAKQSFDGSCGMAHNPETMAIHLDQK
MPERVALLTVGRLAATPNTATSNPKEIALNDCGEKGQRQIMDATTAATKVSMPVSMTNPR
LMNSGSSATGKVALPGWAVSPRILLVDDDSVYRDISRKLLNTIGCTIDLAQDGLEALRKM
GLEKYDLILMDIVMPNLDGISATRNIRQYDALTPIISMTSNFSDSDIMQYIGSGMTDILP
KPFSKSTLYNILEKYCAHLRAIQRVQGSVDPSIVHRSLGNLGLLPPSGATIETAELPIYS
NKADTTFSMTSFPLSSSSSSSSLTPFPAAMMATSLPAHFINPYSSSSSSSSPSTSSTLSS
SSSNVGIISAVATSIAGSSVSTTSASSTSAPAAVSGSRAGGSNVTTDMFWSVAQPYQNIS
STSTGARTLVVAPENDGKIVWIMPPQIIDESYKDTESCKRRKMEES
Download sequence
Identical sequences A0A167KD75
XP_018285849.1.77709 jgi|Phybl1|79068|estExt_fgeneshPB_pg.C_220020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]