SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79130|estExt_fgeneshPB_pg.C_220175 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79130|estExt_fgeneshPB_pg.C_220175
Domain Number 1 Region: 465-509
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000158
Family Rad21/Rec8-like 0.0046
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|79130|estExt_fgeneshPB_pg.C_220175
Domain Number - Region: 167-303
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.08
Family RNA-dependent RNA-polymerase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79130|estExt_fgeneshPB_pg.C_220175
Sequence length 513
Sequence
MSVLPDQIITKQGPLARVWLASHWERKLSKSQFLQTNLEKTIDAISITQQQEPYALRVSG
QLLLGVVRIYSRKTRYLLEDCNEALVKIKLAFKKGNVNMPDINQSVANLGSITLPERLTE
FDILLPSISFNALYTNPVDSRDAVLDNLEGLSFSQDITLTDVQDGLMSGSWGFDMIEQRR
RDMLTDTERPFDFSNNTFFDIEGGRRDAVQTGEFSDFFGMQDIEEPMNKMGLEDNVQPVL
DNNDSVDFDFDLGDDEMNTRPQTNNEFAFPDDQNDALNRQRETSEMTDAPFLETLTQTDV
PAIQEPARRRRRLVVDKVTEIPHDELKQYMQDTSTIIDKSADEQQYKELKSIEKVDLMRP
SALTSVSGLDNLFASLSRKRRASQMIVENQDVHQDNVMQDDTGFDNYDFDAPDMDDIYES
RPPQDLAFEGSQDSYRPNSQSAISTHAQMTLEKIEKITVGNRSVVFRELAPTTKADAARM
FYDILLLSTKDKIQVKQTNAFGDIQIRPHAAAF
Download sequence
Identical sequences A0A167KF97
XP_018286005.1.77709 jgi|Phybl1|79130|estExt_fgeneshPB_pg.C_220175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]