SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79362|estExt_fgeneshPB_pg.C_260033 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79362|estExt_fgeneshPB_pg.C_260033
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-16
Family Linker histone H1/H5 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79362|estExt_fgeneshPB_pg.C_260033
Sequence length 242
Sequence
MGSETKSKPEHPKYEEMIKAAIINLKERTGSSRQAIKKYITSNYLISPSSHFDSQISAAI
KRGKLIGKKSNINVYPSAEKKLFALPKGPAGSVKLVKPEKGESTAADAKKKDAAKKDAAK
KDAAKKDAAKKDAAKKEVTKKDATKKDTPKKDSPKKDAAKKETTKKAATKKEAPKKRDIL
KKKKETTSPIKKAISSTVSKQKTASESKQPSVAVKKTAAKPKAVSAAQKKKSATLKKANS
KK
Download sequence
Identical sequences jgi|Phybl1|79362|estExt_fgeneshPB_pg.C_260033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]