SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79363|estExt_fgeneshPB_pg.C_260036 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79363|estExt_fgeneshPB_pg.C_260036
Domain Number 1 Region: 105-197
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-29
Family Forkhead DNA-binding domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79363|estExt_fgeneshPB_pg.C_260036
Sequence length 508
Sequence
MAEICKNKSKAPTFMGLVSSFSIIQETPQHTKRLPRRRPVEMSHKSHPTSLKKAPVNPLT
ELTFKMATIGDQTIVEDDLDICPARTRKSWPSQIMPWWTPCYPTEKPPFSYATLIGLAIL
SSPEGRLTLSAIYLWISINYPYYSLGEGGWQNSIRHNLSLNKKWFTKLNRRPTQANPGKG
CYWTLVNGTEEMFIYSLTQSSSHTHQYHDINLTTELSLTHRRNSYGSRSSPAEICQELPT
DLSDCGINSSNSSTTIPIYSPSAISVDFATKDIPSSSTLSFYNTFRMVDMTSATRPKPLE
RSSRRSKQQRKRRRSVGRSESSESEYDSGVDVCSEYISSPSKPKSKKIKTEPATTETSSD
SQVFSWQDILESDIPLWQPDPFSEALLLPLDLYDASLWDFCLDSPAVSDQFLGQPSQWSN
SLSMESTPSPADIMENDAKIRECLLELQTHIESVTFTEPQSGPLVINLEEDVTKTYLHFS
DDCSQTSNDNLLYKHNDKPSDSLLNTFL
Download sequence
Identical sequences jgi|Phybl1|79363|estExt_fgeneshPB_pg.C_260036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]