SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79458|estExt_fgeneshPB_pg.C_270067 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79458|estExt_fgeneshPB_pg.C_270067
Domain Number 1 Region: 1087-1173
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000435
Family ELL N2 domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 347-399
Classification Level Classification E-value
Superfamily ClpS-like 0.0000000178
Family Adaptor protein ClpS (YljA) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79458|estExt_fgeneshPB_pg.C_270067
Sequence length 2260
Sequence
MASSSKPSSSSAKLADYLWETPLLYNCVLSQDAKHDIIERLYEALWNGDENIRQQYYFAT
KESLEAASKRQSLQKDGKEPNSVHSSAWHTNSVLPPQDMSSQRGRQCGHVFRKGEPVYRC
SYKYNYNYNPYLRISHSKQYSIFRNCGLDDTCVFCSQCFHATDHDGHDVLFSVSPGSGGC
CDCGDPEAWKTPLQCRIHSPDAAAAAAAVAEISSGRAFVPPEVIKHMQQTFTTVLDFMLD
CFALAPEEVALPSSTEALIKESRRQRNVLQHIGIPSHYLKNPVGRSNTDNLMETEPSSGA
TGCIEEEDVDVDMDKCSGDMSDLHTKIGGSIGSHSKTENEEDEEDDEDNQLYACIAWNDE
AHAFSHVLECIQSATGCDWEKAKHIIDVIHVHGREIIATSHNIDELRKVAAPLAAINFGV
TIRPAQETFREQVCGLLVDWLKELVNGQTRFFNSIEYGDGVIRSVLCETLCGEWELRLPL
ALLTTETRNERASSEAEEDEDEIKHERGEIGIGQTSETEDVEMFDPDSRSSSRPIKINSP
QSLDTSPIIYRNQCDVASIDWEPAAMVKEYQQLKEEEERYGDMLDAKGTAKKPLSDSAAG
KRVIRDSKDAVRLGLHMQKEFEEKLRLDYLMLYDLKLWKEVRISLRELYISTLASSTVYK
KVLGRRLARNYARLAESFLLKDREPENSIILFSVQLLTVPTVSDLLVNEYYFFGIICSTL
AAFFLTDHLRLLLPSQRLRLPTRINCESRAFRTRRYFNAFHDLRYIMNVDMIKQVLAMDP
IYLRQYLDLISLFQGMNAQTCQKDTHVEYESEIWVNAFNVTLQIAKCCRQFSDCFSMLPT
NTLQEKVDTARALVHAITRVLKQIEEWRADDSDDPMEPSSKQPNSQPSISGTAKQVFHEI
LLPHMPPFAVIKYSVCKDPVSFHHPLHWLLAGLLEYASLLSDDVLREAGWTGGFLQVITL
YNTVFEDGNDTTDVLLPILDFPIRTVVFSSQIRAGVWAHHYRDISLRENTYDADVFLLQL
GFVTIDPSRFLATLMDRFDLVSWFMGTTKHENYDPSQTVFMAEEILNLLVVCVCERANVT
GMSIQGKIRREIIHNLCLEPAAYSELTKRIPERLSEHPDFDHILSSVANFKSPMGVNDHG
RYELQTEWFSEVDTYFWHYSRNNREEAEAVLKNRWKKANPKKPEEEFFILPKTDFIGSGP
FKYIGAFLHTPVFNQMITYALWNVRMSKNHKSDTILDQTLHLILLALTDKNSVEAEECDG
FYRYVCETSYPLTSASHSQEHTLFEVMTIFRDEELYSEVHGRFDWIFDRLENCGCKKTSE
IVNAWKYSRLARLQQKEEAAEGSVVELSDIEKKKAAAKERQMKIMAQFAQAQSQFMEKNE
GLYEDELDDAEEGDGLEDASTENPDEIHRFCSYPSGTCILCQEDVNERSPPYGILGLIQA
SNILREAPMDSTELFEDIQTMGPSLDVEWPDRQILPENHNGVVGFPAQNHKTGLYTSTCG
HLMHIKCFEAYCSSIDSRHVAQMTRNHPENRSRKEFMCPLCKSLGNTLFPVFTKGKKESY
PGVLVKTDNASYTKFLQTGVQSAAEKMKQMLGPHRANFGPRRRSSGASKLKDAIATWVPS
LRTTPGGQAVVSDDWISRRPTGFPSSLSLEPSLTMQQDDSVMHYSDRTTAHSPTEGRLGV
FDEDVLYLSAISSIPAIKKSYGRLFDVTTITFREIAGDEIIKEMSTPIKNVDLLWAMLGY
TIMGVEIAARGSAKPKTQDNPEVIPTGTLFDQIPSQTQILLRVLSDTVIAYTSLMSQQDS
SITSSSISPGLSPTMMKIHVLALGRLRQIFPNISLDDLANVIGPNQEKIIIYDNTPLLED
DPFMILSELSLHMASTTKSDIYPFVRTLFLAEITKVTIALLRNQHDQMCTDSLDYQNVLD
GEGNTRGKIPVNVSQEDCVAASEFAFSVMEKMQYSSDDAALLFRNYGQERFCSHLQGFIL
PFLRRALVLMIVRFGLIVPPLSDDDDDFAGNSGNTGHRRSELSRLLDILKLPNFETMLQR
TPEHEHLISAWCKQHIKESQRRWEIEVGSSENAPALPAMVRLDMPTPLYLVALPRRLDQL
FDESMRRVCNKCGTVPTDPALCLFCGTFVCAQSFCCSEEEEGECNLHTLECGGDIGVFLS
VKRCVLILLHNGNGWFIDAPYLDSHGEVDQGLRRGKPQYLNTKRYSEIRKLWLQHTIPVY
IARQIEANYDIGGWTTIQEVNILQAECMDIYLLGKSMQGL
Download sequence
Identical sequences jgi|Phybl1|79458|estExt_fgeneshPB_pg.C_270067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]