SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79553|estExt_fgeneshPB_pg.C_280113 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79553|estExt_fgeneshPB_pg.C_280113
Domain Number 1 Region: 144-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-33
Family Forkhead DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79553|estExt_fgeneshPB_pg.C_280113
Sequence length 607
Sequence
MTDYLTFQTSSPEQSISVNEVSKPLFTFIINAELHKSQNTLMDIDHHYSNACIPPAPTSS
ANYNHNSNVSSTASTIPTTPPISPLATATPRKINELQDQSILKSLNSTDSTDSADSGPSM
HDSTQTPQALLHLVASWQPVDPQDKPPYSYATLIAHAILSSTNRRLTLSEIYSWITTHYP
YYSAGEHGWQNSIRHNLSLNKAFVKLDRTSSKTTLCGKGSFWTIQLGSEKPFIENLVKRR
GPTRKQSVAMDRAVSHRRSRRYPDSDKDTVHRVANNFPLFTTFRMSPIQKTKKIKRTKAQ
SIESQVLQLNVKSTPKPKPKPKPKPNVNVNVKLHSQSEQLRPLLLFTATTTKDTNVENAG
SISQQSRWNRRPDDKESQDKRHENENDSDCDSGVDFRNASLPYSAKSSVSFVSKKNSASE
SSNWIQSREHYHPHQSWSSGGGCLPTLLRSSPFDLPFSSSPSFSSSSSSSSSSVSSGSFG
GSDTSMILDHIPPFFQQQRDETFCDSSSSSLSGYPTTTSPGTSHISRRHLLLDHTTLSWS
PAQAQFVNVRGSSSLNYAYDNTTNINTNTNTNTNDDGGDDKNNNNEPCLLGLGTATASLI
GSLDWGF
Download sequence
Identical sequences jgi|Phybl1|79553|estExt_fgeneshPB_pg.C_280113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]