SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79765|estExt_fgeneshPB_pg.C_330003 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79765|estExt_fgeneshPB_pg.C_330003
Domain Number 1 Region: 199-264
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-22
Family DNA-binding domain from rap30 0.0012
Further Details:      
 
Domain Number 2 Region: 28-134
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 5.75e-21
Family Rap30/74 interaction domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79765|estExt_fgeneshPB_pg.C_330003
Sequence length 299
Sequence
MPDSRTNPDVDALFEDDPGSLDEVVDDEDAEDLKLDNANTKVWLVPKFLANKWKAIDQDN
VNLGSVRIYSQPPPGRSSAISLVLPENEVTENIPREYSISILPGEVTNKFVFTESEHGGK
SISGRVHHECAATPTQFGTYRDIMRKRVIDAGTPQRTVQVLGQDNQPVFVPGASSSMPSS
SFSDFVTAKKPRTDKEKATRMPRNELMDLLFAAFDRYPYWSFKGIVEHTKQPAQYLKEIL
SEICILNKRGPYAGNYQLKPEYKQRSAAERPNGDKEDSKDISSSEEDDEEEEAMEAIHV
Download sequence
Identical sequences jgi|Phybl1|79765|estExt_fgeneshPB_pg.C_330003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]