SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|80170|estExt_fgeneshPB_pg.C_450037 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|80170|estExt_fgeneshPB_pg.C_450037
Domain Number 1 Region: 286-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.76e-16
Family Z-DNA binding domain 0.061
Further Details:      
 
Domain Number 2 Region: 82-213
Classification Level Classification E-value
Superfamily TPR-like 0.0000569
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|80170|estExt_fgeneshPB_pg.C_450037
Sequence length 389
Sequence
MSIPAQDNTLQKIPDLYLAHHRFIVNQGPVEQRQNAKNELLKEIEQKNMAPFYKFIVEEF
KIPFDQQLYTRMEAANKEELKKFDEKVVDAEQNQGETEINEALLGKADYYSSIGDKESAL
TGYNNLLNKSITLGTRIDIVFAIVRIGFFFDDYNLVRSKLDKLKELIEQGGDWDRRNRLK
AYEGVYLMSIRDFKGAASLFIDTLSTFTSTEMMSYQDFVKYAVLTSVISMQRVDIKKKVL
DAPEILEVISDIPYLEDFMTSLYNCNYSDFFRALANVEETHLRTSRYLYAHMRYYTREMR
IVAYAQLLESYRSLTLASMAQAFGVSEDFIDRELYKFVAAGRLNCVIDKVNGVIETNRPD
AKNAQYQTVVKQGDLLLNRVQKLSRVIDV
Download sequence
Identical sequences A0A167PMG1
XP_018296256.1.77709 jgi|Phybl1|80170|estExt_fgeneshPB_pg.C_450037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]