SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|80280|estExt_fgeneshPB_pg.C_490005 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|80280|estExt_fgeneshPB_pg.C_490005
Domain Number 1 Region: 253-337
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-35
Family Forkhead DNA-binding domain 0.00011
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|80280|estExt_fgeneshPB_pg.C_490005
Domain Number - Region: 588-674
Classification Level Classification E-value
Superfamily IpaD-like 0.0575
Family IpaD-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|80280|estExt_fgeneshPB_pg.C_490005
Sequence length 898
Sequence
MSNIYTSHGMNTLDWMDRTSHSHQAAATSMSGVTGGTTTAAGLSDGTTRNQSIFHAHLPP
INASSHSMMSDSLADYIGHNNTNTTITSSNQSSPSLLSSSSSSAASSSSLSIAPVRAYNG
YTNPQVTESQKLTAQTAFTLSSSGLTSAPWTAATQKQSDNDDEEEDEEDEDEDVGEDEDK
DMSQVNRSQSGLNSSSSGAAISPLSSSPSSSSTPLKNTVTTTTATTATTSSSNTNTTKST
SNVVRVEKNTDGKPPYSYATLIKYAIENCSERRLTLSQIYQWVIDHYPYYSTAGTGWKNS
IRHNLSLNKCFLRVPRPTNEPGKGSYWTIDYNALDAEQRSKNSLTTRGRTNRSHSHPALS
TPYHPESHWSQSVAASASSSIRAGLIRDSSRSMSFDTGSKMPRQATATANTISNNTATGL
ITTSGSYGNISSINTVNSLSAAIASSSLGTGMGAMTPATGGAFGSLGTSGYSTSGAMFPY
KTSTFNLTSSSSAAAVAAAAAAASSASSSSSLMGTYGVNDTHCIHGRPLNKPRSVSRSVL
NYSTDGYSRQPEFGFDSIGMPMNNNTPLAISTTTTDGSFTTPSFDFGRSDRRANPQQYHH
HHQHHNHQAHHQHQHYHQHNQQQQYERFGEPIHHEMYDINKPYSSAYSSAYSTTTTTNNS
SSNSGPSSGYSMGWSLKNAYGSRGGSGGNAYLYGSSAAPGSAAAAIVSGSHPNTTANGNG
NGNSNASASASTSSMSSPQPPSLGWSTNDMNSASLNNSSSSSSSSPMACDGSITGGNASA
SGNGNGVGIGNGGGRPSSHKPSMHGSHSSVSSLDSFTTQPYRRIQDSFGATPSPVHYPFV
DQGSVSPLTPIYSTIPVHQQQQNTANITTNTAMHPPKKNISQIMTPISNGAFEWDSTF
Download sequence
Identical sequences jgi|Phybl1|80280|estExt_fgeneshPB_pg.C_490005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]