SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|80292|estExt_fgeneshPB_pg.C_490041 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|80292|estExt_fgeneshPB_pg.C_490041
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-40
Family Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 136-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000462
Family Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|80292|estExt_fgeneshPB_pg.C_490041
Sequence length 222
Sequence
MPATTIAHRPQTIQSLIDGVERYNPENVNVLEEYLATQCKNGDYDLMANLAILKLYQFNP
NLASTNVIINILAKALTAVPAPDFNLCLYLLSEQATLPAVEKLTTLQQLLEQSRYAKFWE
TYNNEEYKSLTAAVVGFEAAIRQVIARVVAMSHQVISTSVLSSYLALSGDELTKFCNEQQ
WQKKDDVVQIPINEDNEAKAVVVIENIKFEQLTKVIGYSNEM
Download sequence
Identical sequences A0A167M183
XP_018289546.1.77709 jgi|Phybl1|80292|estExt_fgeneshPB_pg.C_490041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]