SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|80409|estExt_fgeneshPB_pg.C_570013 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|80409|estExt_fgeneshPB_pg.C_570013
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-28
Family VPS36 N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 395-502
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.14e-25
Family Transcriptional regulator IclR, N-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 184-208
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000471
Family Ran binding protein zinc finger-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|80409|estExt_fgeneshPB_pg.C_570013
Sequence length 504
Sequence
MYFQPTQLSTSRRPDLKAGESLIVQQASVGLYEGKNKVESAQDGVCYLTSHRIIYVDSKD
SGQNSCEIPLNSIREIESYARFLMSSPKLILHLDVKALSDHSRPPAPVISTSVAGVWACP
ICFFTNQATVDKCQLCGVRHVTTNDNNSSPSQPQKQTQSVQQQHRQQQQQQQQQQNQLPA
NDDGNGSHCRVCTFINHPSLNQCEMCGADLITEPLFTENAIESLVIEDDPHVRIAFRHGG
QPRFLQNLKNAIQVKAWEAPVIEESVPVIKSKGVGISAIRERVEQSTQKANDTMSDAFQD
LNRLMTKATEMVKLAESISLKMSRDITTDNDKDMATLKGYLLNLGIASPVTRDSAGSIYH
QELARELADFLTKFLDSSDSIKSLADVYCIFNRARGVALVSPEDLYKASTQFESLQLPFR
LKKFPSGLLVVQSVAMDDDQAASRILSHVKNHGHLTALQLAEIEHWALAVASEQLLMTEQ
KGLLCRDEGPVGLTFYENLFCSVN
Download sequence
Identical sequences A0A162N1Z0
jgi|Phybl1|80409|estExt_fgeneshPB_pg.C_570013 XP_018285728.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]