SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407936118|ref|YP_006851760.1| from Propionibacterium acnes C1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407936118|ref|YP_006851760.1|
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.51e-39
Family Cytidine deaminase 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407936118|ref|YP_006851760.1|
Sequence length 137
Comment cytidine deaminase [Propionibacterium acnes C1]
Sequence
MDVDWDALRCRAHELTKRAYVPYSHFPVGAAGLAEDGRVVVGCNVENAGYGVTLCAECGL
ISDLVAGGGGHLLAFCCVDAMGETIMPCGRCRQLLWEHGGPTMLIDTPAGVQTMTEVLPQ
AFGVDNLDRVANQQEKS
Download sequence
Identical sequences A0A1J4X4Q3 A0A1N5ATJ5 A0A1W9TS43 A0A2B7ITQ0 D1YER6 D4H9D7 W4TWX8 W4U6B5 W4UKV3
gi|386024669|ref|YP_005942974.1| gi|482890812|ref|YP_007887975.1| WP_002514731.1.101196 WP_002514731.1.102089 WP_002514731.1.102131 WP_002514731.1.1248 WP_002514731.1.14952 WP_002514731.1.15006 WP_002514731.1.1505 WP_002514731.1.17579 WP_002514731.1.17969 WP_002514731.1.18145 WP_002514731.1.18363 WP_002514731.1.20232 WP_002514731.1.22236 WP_002514731.1.22959 WP_002514731.1.25499 WP_002514731.1.2563 WP_002514731.1.26091 WP_002514731.1.2617 WP_002514731.1.26893 WP_002514731.1.26956 WP_002514731.1.27635 WP_002514731.1.28533 WP_002514731.1.2928 WP_002514731.1.29382 WP_002514731.1.29850 WP_002514731.1.30003 WP_002514731.1.31063 WP_002514731.1.31624 WP_002514731.1.3171 WP_002514731.1.32488 WP_002514731.1.33260 WP_002514731.1.34331 WP_002514731.1.34387 WP_002514731.1.36413 WP_002514731.1.3652 WP_002514731.1.37742 WP_002514731.1.38538 WP_002514731.1.40065 WP_002514731.1.41101 WP_002514731.1.41264 WP_002514731.1.41273 WP_002514731.1.41331 WP_002514731.1.42227 WP_002514731.1.42486 WP_002514731.1.43449 WP_002514731.1.43585 WP_002514731.1.43679 WP_002514731.1.43983 WP_002514731.1.44257 WP_002514731.1.45324 WP_002514731.1.46705 WP_002514731.1.4830 WP_002514731.1.48475 WP_002514731.1.49294 WP_002514731.1.49524 WP_002514731.1.50101 WP_002514731.1.50375 WP_002514731.1.50378 WP_002514731.1.50533 WP_002514731.1.51523 WP_002514731.1.53219 WP_002514731.1.5458 WP_002514731.1.56110 WP_002514731.1.56441 WP_002514731.1.56454 WP_002514731.1.56826 WP_002514731.1.57145 WP_002514731.1.57563 WP_002514731.1.58125 WP_002514731.1.59251 WP_002514731.1.59962 WP_002514731.1.59982 WP_002514731.1.60466 WP_002514731.1.60649 WP_002514731.1.60667 WP_002514731.1.61734 WP_002514731.1.62864 WP_002514731.1.65671 WP_002514731.1.66193 WP_002514731.1.67054 WP_002514731.1.67213 WP_002514731.1.67247 WP_002514731.1.6930 WP_002514731.1.69974 WP_002514731.1.70135 WP_002514731.1.7197 WP_002514731.1.72191 WP_002514731.1.73086 WP_002514731.1.73414 WP_002514731.1.74417 WP_002514731.1.74746 WP_002514731.1.74916 WP_002514731.1.7599 WP_002514731.1.76554 WP_002514731.1.767 WP_002514731.1.76841 WP_002514731.1.77039 WP_002514731.1.7771 WP_002514731.1.78128 WP_002514731.1.79798 WP_002514731.1.80166 WP_002514731.1.80187 WP_002514731.1.81031 WP_002514731.1.81478 WP_002514731.1.821 WP_002514731.1.82350 WP_002514731.1.83430 WP_002514731.1.85929 WP_002514731.1.86359 WP_002514731.1.87452 WP_002514731.1.89010 WP_002514731.1.90730 WP_002514731.1.90935 WP_002514731.1.91146 WP_002514731.1.91610 WP_002514731.1.92292 WP_002514731.1.97417 WP_002514731.1.97839 WP_002514731.1.98061 WP_002514731.1.98214 WP_002514731.1.99435 gi|387504101|ref|YP_005945330.1| gi|407936118|ref|YP_006851760.1| gi|365974562|ref|YP_004956121.1| gi|365963383|ref|YP_004944949.1| gi|386069933|ref|YP_005984829.1| gi|365965626|ref|YP_004947191.1| gi|295131254|ref|YP_003581917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]