SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407936331|ref|YP_006851973.1| from Propionibacterium acnes C1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407936331|ref|YP_006851973.1|
Domain Number 1 Region: 15-139
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.43e-25
Family Deoxycytidylate deaminase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407936331|ref|YP_006851973.1|
Sequence length 152
Comment cytidine and deoxycytidylate deaminase zinc-binding region [Propionibacterium acnes C1]
Sequence
MAEVNGKVVTVPDWDQYFLGIAEAVSARAKCTRRRVGALLVHEHRIIATGYNGAAPGRPD
CLEGACPRGRLDYGEVPAFSDYDVPGSPGFCIAIHAEMNALLFATRDTAGSTAYVTDKPC
SGCRKALAAAGVVRAVWPDGELGEDDLVNWQL
Download sequence
Identical sequences A0A1N5BD65 A0A2B7I3D4 D1YFD6 D4HA92 E6D6K2 F1UJ65 F9NWW5 U7JAT6 U7M213 W4UL64
gi|407936331|ref|YP_006851973.1| gi|295131477|ref|YP_003582140.1| gi|386024890|ref|YP_005943195.1| gi|365974771|ref|YP_004956330.1| gi|482891011|ref|YP_007888174.1| gi|386070142|ref|YP_005985038.1| WP_002514951.1.102089 WP_002514951.1.102131 WP_002514951.1.1248 WP_002514951.1.1505 WP_002514951.1.17579 WP_002514951.1.18145 WP_002514951.1.20232 WP_002514951.1.22236 WP_002514951.1.22959 WP_002514951.1.23000 WP_002514951.1.25499 WP_002514951.1.2563 WP_002514951.1.26091 WP_002514951.1.26956 WP_002514951.1.27635 WP_002514951.1.2928 WP_002514951.1.29382 WP_002514951.1.29850 WP_002514951.1.30003 WP_002514951.1.31063 WP_002514951.1.31800 WP_002514951.1.32488 WP_002514951.1.33260 WP_002514951.1.3428 WP_002514951.1.34331 WP_002514951.1.34387 WP_002514951.1.36413 WP_002514951.1.3652 WP_002514951.1.37742 WP_002514951.1.38538 WP_002514951.1.40065 WP_002514951.1.41101 WP_002514951.1.41264 WP_002514951.1.41273 WP_002514951.1.41331 WP_002514951.1.42227 WP_002514951.1.42486 WP_002514951.1.4265 WP_002514951.1.43585 WP_002514951.1.43679 WP_002514951.1.43983 WP_002514951.1.44257 WP_002514951.1.45324 WP_002514951.1.46705 WP_002514951.1.47018 WP_002514951.1.47600 WP_002514951.1.48202 WP_002514951.1.4830 WP_002514951.1.48475 WP_002514951.1.49524 WP_002514951.1.50101 WP_002514951.1.50378 WP_002514951.1.51523 WP_002514951.1.53219 WP_002514951.1.54292 WP_002514951.1.5458 WP_002514951.1.56110 WP_002514951.1.56441 WP_002514951.1.56826 WP_002514951.1.57145 WP_002514951.1.57563 WP_002514951.1.58125 WP_002514951.1.59962 WP_002514951.1.59982 WP_002514951.1.60466 WP_002514951.1.60649 WP_002514951.1.60667 WP_002514951.1.61734 WP_002514951.1.62864 WP_002514951.1.65671 WP_002514951.1.66193 WP_002514951.1.66916 WP_002514951.1.67054 WP_002514951.1.67247 WP_002514951.1.6930 WP_002514951.1.70496 WP_002514951.1.7197 WP_002514951.1.73086 WP_002514951.1.73414 WP_002514951.1.74417 WP_002514951.1.74916 WP_002514951.1.7599 WP_002514951.1.76554 WP_002514951.1.767 WP_002514951.1.76841 WP_002514951.1.77039 WP_002514951.1.78128 WP_002514951.1.79798 WP_002514951.1.80187 WP_002514951.1.81031 WP_002514951.1.81478 WP_002514951.1.821 WP_002514951.1.82350 WP_002514951.1.83430 WP_002514951.1.8581 WP_002514951.1.85929 WP_002514951.1.86359 WP_002514951.1.87452 WP_002514951.1.89010 WP_002514951.1.90730 WP_002514951.1.90935 WP_002514951.1.91146 WP_002514951.1.91798 WP_002514951.1.97839 WP_002514951.1.99435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]