SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407936550|ref|YP_006852192.1| from Propionibacterium acnes C1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407936550|ref|YP_006852192.1|
Domain Number 1 Region: 9-154
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.6e-50
Family Deoxycytidylate deaminase-like 0.0000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407936550|ref|YP_006852192.1|
Sequence length 160
Comment cytidine and deoxycytidylate deaminase zinc-binding region [Propionibacterium acnes C1]
Sequence
MAGPVPGWRQAMTQALDVARRAATWGDVPIGAVILGANGEVLSEAGNERERTGDPTAHAE
VLAIRRAAEARDGWRLGDCTLVVTLEPCTMCAGTIVAARIPRVVFGAFDPKAGAVSSLFD
AMRDPRLPHRPKVVTGVMAEESSALLREFFDGHRACTVDG
Download sequence
Identical sequences A0A1N4W5L1 D4HB36
gi|407936550|ref|YP_006852192.1| gi|482891215|ref|YP_007888378.1| gi|365963802|ref|YP_004945368.1| gi|387504538|ref|YP_005945767.1| gi|295131701|ref|YP_003582364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]