SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA14988 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA14988
Domain Number 1 Region: 53-268
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-31
Family Nitrogenase iron protein-like 0.023
Further Details:      
 
Weak hits

Sequence:  CCA14988
Domain Number - Region: 285-398
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.000145
Family DRTGG domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CCA14988
Sequence length 424
Comment pep:novel supercontig:ENA1:FR824052:200654:202153:-1 gene:ALNC14_011310 transcript:CCA14988 description:"conserved hypothetical protein"
Sequence
MVETVENVLDTVMISSSSLLSTNERRRNRFVPISLMLLNYAICCITDMHSKAAVYVAATR
QHVGKTSTCLGLLQGLTNRCKRIGFLKPVGQQSVVLENNLRVDKDVVVAKEIFGLPTCEY
SDMSPIVIPPGYTKQYLDGKIMLETQLQQIKKSFKRIAEKNDFTLVEGTGHTGVGSIVNI
NNARIAAELGIDIILIANGGIGSSFDDLALNYHMCKAYGVQVRGVILNKVFPAKVDMIWE
YFPRALAEWKVPLIGVVPNLPSIARSSMLDFEGLFKTELLSGHARRVQKYYRVSLVTSGL
RRFLVKLSSNLFDDTLFVTHASRNDIILGFLSHAQNYEFKTGKCFTGGLVLTGVPPVDQP
QNYIMDIIQQSSAPVLYAPMETVKAMELITQHTAKFSANDRDRVLECAKHYEKFLDFNII
LQNK
Download sequence
Identical sequences F0W1Q9
CCA14988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]