SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA22775 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA22775
Domain Number 1 Region: 421-742
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 3.54e-84
Family Phosphotransacetylase 0.00000036
Further Details:      
 
Domain Number 2 Region: 1084-1262
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.03e-23
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 773-833,883-982,1019-1078
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000458
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 4 Region: 42-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000717
Family Nitrogenase iron protein-like 0.053
Further Details:      
 
Domain Number 5 Region: 245-374
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00000000000745
Family DRTGG domain 0.0037
Further Details:      
 
Domain Number 6 Region: 1342-1516
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000392
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCA22775
Sequence length 1529
Comment pep:novel supercontig:ENA1:FR824212:44630:49272:-1 gene:ALNC14_089180 transcript:CCA22775 description:"phosphate acetyltransferase putative"
Sequence
MFRNRMDHVVRVWRRSFSSCTPIQRLYLTSTDYVPHTAPLLLGLASVLEQKYGRIGYFRP
ILPTRKSAPIDHHVPLMQKLLGLEPHEKKPLYAVTSEEAVDYCLRNQQDQLIDRVLFTLE
KAQEEHDFMIIEGSAFPSHETNSVSWQLHKQIANALGARVVLCMDAGTPDFPSSDSELID
AIVIRALLGREQAEADRVGYFGTLINRVGTSDPSAFALRLEKAFEKHKLPYLGFLPYDRI
LASRRLNEVADRLGAKAIVDANESAKTVSISEIVVASSQLKEFLHHVKDRKDGLLVLTSA
DRSDMLLGLLASRLPGILPRIAGILLTNGEYPDSQTQAILQGVAESRKAGLSIPIYLVGM
DTYTASAKLSRIRTGILPTSVQKITASQALMERFMNKKLLVGELAHGFISHCSPKQFEHI
LYIKARQSHRHIVLPEGNDDRILRAADEILRSNLAKLTILGDVHEIQLQAKTLGLDLSSA
TLINPVDSEHLERYIDRYLFLRRHKGVVKDMARDVVIDATYFGTMMVEMGDADGMVSGAY
HTTADTIRPALQLIKTFPDRPLVSSIFFMGLEDGVRIFGDCAVNANPSAEQLAQIAVTSA
ESAQAFGMHPRVAMLSYATGESNSGPNVDKVREATRIAQTLRPDLDIFGPIQYDAAVDQA
VAKQKIKTLTAQSERVGGHANVLIFPDLNAGNNTYKAVQQATRCIAIGPMLQGLRKPVND
LSRGASVKDIVTTVAITAIQAHQMQSVSVSSDSSLVPGKAKAGSSSSKKSNQYDVIAISL
LVFRLVEFAYLSFSIPLRVGFYFDPFQTHASGSWSTSLTVFTLLDVVAEAIAIGHVAGLG
KRQRRAIASLADAAASHNVHGRRARATPMRSPSFRDETSDSVRSSDTRVVEGLSVIHLVS
MVPLECIAGLTGANTLHVLRLHRLLRLEGFSSWWTSVNETFASVGFLKRMHSGEKLLYQT
ILVGGLVCHIAACGYMLIAHVECGLEMELCELVIASSAHRRLDTMASRTCWAVEDRLLHA
STFRKYSRSLYWASRTLITLGYYDVAPRTDLETIFSIGIQLLGAVFSTSIIATLLFIFRY
RNLRRAKFNAHVDNAKHLMKLYKLPKKMQKRVFQYYDHVWSVYSGLPEEHHVLEKLPEHL
QTQIRYQVRIKPLYSVSFLGKEQLEFVNMLAVELLHRIYAPKDWIVRRVPTSLYFVSIGE
VVLLHKTAREGRTKLIGVGTHFGSNALLYADWNVDIVARAHTFCELHHLPHHAFQDTLHA
FFGDQAGVQLERMRVKLSRQDQQQQKTEKMLGKMITQRPTVFSIGDVQEDKLQAPVGVYR
TIHWARNIRPRNWFRDWTLPESSFRYCWEHLRFACLTFIAFEVPFYLAFDGGWPFFMDDR
YAKEWIWSIVVELFFGLDFIFQCRYFTVQDPVLQTLVHDPNYLVEHYKRNGMRMDAVALI
PLPLILEILSFGPIHSRWMYLFRLFRLCRLSKFHFYLSEIVRLRNLSSRVEHALGLILYV
TWTMHVTGCLWFEMARLSVPPVFPIEHKA
Download sequence
Identical sequences F0WN86
CCA22775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]