SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA13878 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA13878
Domain Number 1 Region: 975-1157
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-36
Family Fibrinogen C-terminal domain-like 0.0000659
Further Details:      
 
Domain Number 2 Region: 8862-8967
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-17
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 2351-2445
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000485
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 9991-10103
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000124
Family Cadherin 0.0076
Further Details:      
 
Domain Number 5 Region: 11732-11835
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000657
Family Cadherin 0.0026
Further Details:      
 
Domain Number 6 Region: 10784-10891
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0033
Further Details:      
 
Domain Number 7 Region: 8287-8397
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.0042
Further Details:      
 
Domain Number 8 Region: 6859-6960
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000006
Family Cadherin 0.0021
Further Details:      
 
Domain Number 9 Region: 6537-6644
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000857
Family Cadherin 0.0021
Further Details:      
 
Domain Number 10 Region: 7070-7167
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0049
Further Details:      
 
Domain Number 11 Region: 3035-3201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000222
Family Pentraxin (pentaxin) 0.059
Further Details:      
 
Domain Number 12 Region: 4942-5035
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000314
Family Cadherin 0.0047
Further Details:      
 
Domain Number 13 Region: 1931-2058
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000642
Family Cadherin 0.0049
Further Details:      
 
Domain Number 14 Region: 9648-9755
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000134
Family Cadherin 0.0043
Further Details:      
 
Domain Number 15 Region: 7754-7833
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0016
Further Details:      
 
Domain Number 16 Region: 8748-8862
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0053
Further Details:      
 
Domain Number 17 Region: 11110-11230
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000385
Family Cadherin 0.0032
Further Details:      
 
Domain Number 18 Region: 4622-4719
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000557
Family Cadherin 0.0026
Further Details:      
 
Domain Number 19 Region: 10886-11009
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000114
Family Cadherin 0.0045
Further Details:      
 
Domain Number 20 Region: 2572-2661
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000005
Family Cadherin 0.0046
Further Details:      
 
Domain Number 21 Region: 3382-3461
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000957
Family Cadherin 0.0042
Further Details:      
 
Domain Number 22 Region: 8999-9082
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0037
Further Details:      
 
Domain Number 23 Region: 3465-3557
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0056
Further Details:      
 
Domain Number 24 Region: 5231-5331
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000328
Family Cadherin 0.0014
Further Details:      
 
Domain Number 25 Region: 6964-7062
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000328
Family Cadherin 0.0038
Further Details:      
 
Domain Number 26 Region: 4501-4629
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000771
Family Cadherin 0.0072
Further Details:      
 
Domain Number 27 Region: 9092-9195
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000814
Family Cadherin 0.0068
Further Details:      
 
Domain Number 28 Region: 4742-4847
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000828
Family Cadherin 0.0032
Further Details:      
 
Domain Number 29 Region: 9417-9524
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000857
Family Cadherin 0.0044
Further Details:      
 
Domain Number 30 Region: 8174-8290
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000011
Family Cadherin 0.0032
Further Details:      
 
Domain Number 31 Region: 2039-2138
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000114
Family Cadherin 0.0053
Further Details:      
 
Domain Number 32 Region: 9203-9306
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000123
Family Cadherin 0.0048
Further Details:      
 
Domain Number 33 Region: 9536-9645
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000141
Family Cadherin 0.0036
Further Details:      
 
Domain Number 34 Region: 6652-6749
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000286
Family Cadherin 0.0052
Further Details:      
 
Domain Number 35 Region: 5666-5774
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000414
Family Cadherin 0.005
Further Details:      
 
Domain Number 36 Region: 8514-8608
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000443
Family Cadherin 0.0076
Further Details:      
 
Domain Number 37 Region: 8074-8173
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.012
Further Details:      
 
Domain Number 38 Region: 6750-6857
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000671
Family Cadherin 0.0075
Further Details:      
 
Domain Number 39 Region: 1162-1176,1210-1326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 40 Region: 6172-6339
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000826
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.077
Further Details:      
 
Domain Number 41 Region: 2792-2874
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000885
Family Cadherin 0.01
Further Details:      
 
Domain Number 42 Region: 3858-3958
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000013
Family Cadherin 0.0036
Further Details:      
 
Domain Number 43 Region: 4198-4293
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0074
Further Details:      
 
Domain Number 44 Region: 6349-6427
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0059
Further Details:      
 
Domain Number 45 Region: 8402-8483
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000003
Family Cadherin 0.0035
Further Details:      
 
Domain Number 46 Region: 10205-10328
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000428
Family Cadherin 0.0054
Further Details:      
 
Domain Number 47 Region: 5434-5586
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000457
Family Cadherin 0.0068
Further Details:      
 
Domain Number 48 Region: 7845-7941
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000685
Family Cadherin 0.005
Further Details:      
 
Domain Number 49 Region: 11008-11114
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000013
Family Cadherin 0.0045
Further Details:      
 
Domain Number 50 Region: 9781-9885
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000141
Family Cadherin 0.0055
Further Details:      
 
Domain Number 51 Region: 7167-7263
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000143
Family Cadherin 0.0069
Further Details:      
 
Domain Number 52 Region: 10313-10433
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.004
Further Details:      
 
Domain Number 53 Region: 10690-10780
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.0042
Further Details:      
 
Domain Number 54 Region: 5570-5670
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000186
Family Cadherin 0.0038
Further Details:      
 
Domain Number 55 Region: 5920-6079
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000253
Family Clostridium neurotoxins, the second last domain 0.036
Further Details:      
 
Domain Number 56 Region: 2150-2238
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000314
Family Cadherin 0.0079
Further Details:      
 
Domain Number 57 Region: 1880-1939
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000485
Family Cadherin 0.0059
Further Details:      
 
Domain Number 58 Region: 4826-4931
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000614
Family Cadherin 0.0081
Further Details:      
 
Domain Number 59 Region: 5333-5439
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000671
Family Cadherin 0.0054
Further Details:      
 
Domain Number 60 Region: 12885-12965
Classification Level Classification E-value
Superfamily E set domains 0.0000168
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 61 Region: 2667-2773
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000286
Family Cadherin 0.0087
Further Details:      
 
Domain Number 62 Region: 9304-9414
Classification Level Classification E-value
Superfamily Cadherin-like 0.00003
Family Cadherin 0.0093
Further Details:      
 
Domain Number 63 Region: 3567-3621
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000343
Family Cadherin 0.0062
Further Details:      
 
Domain Number 64 Region: 3783-3860
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000357
Family Cadherin 0.014
Further Details:      
 
Domain Number 65 Region: 3717-3755
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000785
Family Cadherin 0.0086
Further Details:      
 
Weak hits

Sequence:  CCA13878
Domain Number - Region: 6439-6535
Classification Level Classification E-value
Superfamily Cadherin-like 0.000134
Family Cadherin 0.0095
Further Details:      
 
Domain Number - Region: 11617-11725
Classification Level Classification E-value
Superfamily Cadherin-like 0.000457
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 10119-10212
Classification Level Classification E-value
Superfamily Cadherin-like 0.000528
Family Cadherin 0.007
Further Details:      
 
Domain Number - Region: 5787-5884
Classification Level Classification E-value
Superfamily Cadherin-like 0.000671
Family Cadherin 0.0055
Further Details:      
 
Domain Number - Region: 12066-12154
Classification Level Classification E-value
Superfamily E set domains 0.00165
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number - Region: 12820-12880
Classification Level Classification E-value
Superfamily E set domains 0.00187
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Domain Number - Region: 11509-11594
Classification Level Classification E-value
Superfamily Cadherin-like 0.00204
Family Cadherin 0.0055
Further Details:      
 
Domain Number - Region: 9896-9976
Classification Level Classification E-value
Superfamily Cadherin-like 0.00228
Family Cadherin 0.0064
Further Details:      
 
Domain Number - Region: 11318-11376
Classification Level Classification E-value
Superfamily Cadherin-like 0.00314
Family Cadherin 0.011
Further Details:      
 
Domain Number - Region: 410-441
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Hairpin loop containing domain 0.028
Further Details:      
 
Domain Number - Region: 13235-13283
Classification Level Classification E-value
Superfamily E set domains 0.0091
Family E-set domains of sugar-utilizing enzymes 0.094
Further Details:      
 
Domain Number - Region: 4406-4505
Classification Level Classification E-value
Superfamily Cadherin-like 0.0103
Family Cadherin 0.0056
Further Details:      
 
Domain Number - Region: 4287-4384
Classification Level Classification E-value
Superfamily Cadherin-like 0.0157
Family Cadherin 0.0047
Further Details:      
 
Domain Number - Region: 11368-11481
Classification Level Classification E-value
Superfamily Cadherin-like 0.0171
Family Cadherin 0.0077
Further Details:      
 
Domain Number - Region: 12164-12257
Classification Level Classification E-value
Superfamily E set domains 0.0218
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number - Region: 7962-8060
Classification Level Classification E-value
Superfamily Cadherin-like 0.0257
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 561-610
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0284
Family Fibrinogen C-terminal domain-like 0.0081
Further Details:      
 
Domain Number - Region: 8612-8745
Classification Level Classification E-value
Superfamily Cadherin-like 0.0571
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 12375-12451
Classification Level Classification E-value
Superfamily E set domains 0.0902
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCA13878
Sequence length 14400
Comment pep:novel supercontig:ENA1:FR824046:36942:80293:1 gene:ALNC14_000210 transcript:CCA13878 description:"protocadherinlike protein putative"
Sequence
MGTSGYWDNVMTKMFRADMQITPGFHTIELYAFSATFEPSSIYFSRENSSLAVVTTSSLV
SALTDWNPVLDGDPATYVAVGQERATCKRDVERRGSIFQFQPAPLAGQYRLRLRSLPNPS
CGNMDNYNSSSRASVTYLPTESANISRTSTLVTLLAARSGWDAIPDMGGTTLQTSKRSGV
VVASFTGRLFLNDITAQSFSLDLTFAVGCPIGSGNKSELTVQLHADDRFFQPSGLPLDWS
YFYQFTAPSNKTNTTVCVQYIYSGSKPAKMVGGRTSAVFLPGASLINISGLHNVTNVRRG
PITLFSQQIDVEFPSTIIVRVSSIICRNSPNEKLTARIAKNGTYLYDGFFTSSSDIVTNG
SCEILNVHTVMDTSTDSTVTISMDLTTSTSAGYQLKMNQGQILIMERGARLSYDDCVDRC
NRHYLCKSLSFSNISRSCMLFMNTNEVELSSDSNHSVALRIPDSDTNLHMWTRLSNRDWE
SIERKKKNPTFLLPIASCSQNNQCNTTGTLEERCRALCHAQAPSDGCVGFIFENGNCYSF
TSQELHLVIRSNNFNSPGTRDIHINIPSSCRQIKLYDSISSSGMYVISTSTGFYWIFCDM
VADYGKGYTIAPCDFGSDDVYCIPTSGPTDLDTCKSMGMTTVILRSPSHFAAMHRRFGAY
YFDSIPGLSNSMQNNVLSYPTQADQTSSWSASDGGTFWLRDTYFAEDEFYAPNLPFIKKG
WLGMHSIASGQSVEDGITIGFSGIGSSTNKYLCSINDVSPVIFQGTVVEYLFDSNRDGVT
WTASWNESKFYQLCNDVRVLGGPSLAKTYAFAENVFKLHPLSSRVRITFTLYIQSSAVKP
FWAQSFTTGTSAMLVYVQDKLVSRIPIRNLMQESDREISCSPSDGLVKFTSSLFSPMQSL
NLLSSKSSLYRSQHQIRGISSVRNSSAPVNLKFVYSSGNDPESSLIAAIGFSNVKIEADY
AFQNSLGVSADAPASSCAQIESQRERDGDPNPDGLYYLKLDSSQATFRVYCSRGWLVAQR
RGRGTVSFNQKWAEYREGFGIGTKEWWIGNEIISQVSKVPLELKVVLSKKETTGTAYYSY
FHVDDEANKYMLNIDGYDTAQSTIPDALKYINSTYFSTVDVDNDFDPRLHCARSGQSGFW
YSDCKSNSKSDLNAPFGKISACSNFANWFQGWCTSSDSIVWGNIDGFDGSEILLRQATCP
LGSSPVAGTCFSCPAGSYMQPAQKKCQLCPAGTYNSLSGKSDVSSCLTCPAGYRCASGST
TFTKCEAGTYAKAGSEVCTNAPEGSVTVTDGATEKDFIICRNGSYSKAGAKACSPTAAGF
FCSSSDQLGNTISSFIGCQYSSLLPCPSANYYCPEGNTGPLNVPAGYYSVGADSAKLKSG
VLICPIGSYCQNGARQQCPPGRYGSQEGLVAPLCSGRCSSGCICDSGSINACPMTASSSA
EIVFGLASITHAIIPIRFQPPMYSGSTENSQALIGSIVAAEYDSSSPPISVDIFDYTDIG
PASFSSLWPASTGGFGHNITIKFVDRGLLNSQYSEGVTYEMQLPMAGFDHGIVVVVDDKV
LVGRTFNRTLTFSFQSSPGIRTVRILAAESRFIWKRNILFRRGVAPLIDTMNRLRCDSLD
MSLVYLQISCMVCGSVSTSCPSNQLMINDRKIHEVYQSANIYLYAIVSGQSGSIIMSKQI
SAESLTILVGDLKSCTAGDIAVVIGISIMSSTPANELTSVLARFGAAPDDIKSSLPGSFV
FFGAYDPSNKLSLSASWTTFRSLTSGSDGLSIFHDVPLVQTTKNYKAVAIPSGYYSVPES
LPYERRYALEACPSGYTCTSGLRSFAYAFESQVCAKRTHTLKINEANPTATSAESFLLTN
APLGIRYVLEQPSQPSTSCNISTPFILNRTTGRISLCMTLDYETINAYTLRLLVQENSQS
AVYFPACRITVEVLDINEPPILIAPNAPLTLIENSLAPKVLSPALSVWDPDTFDTIKLAI
VLGGSSPFAISQNGLISAIEALDFEQQSLYRLNISATDSGGLATFTIVVVYVLDASESPV
CSSSSFELPENSYTPTLIARMSSFVVDPDINDTCSYVILDSTLTAGRAPYFQVDIRTGQL
SLVHPLNYESDRVVDFSVRFVDRTELYTSCKYTINVTDRNDPPGLLPGLFSVAEHCSGNN
CLVADLSSFGFDEDFNSTIIYQLLNGTNVARILSNTLLWLLQPIDYEATSLLYISVIAID
DKGARSSPQTMRVRILDINEAPVARTFNCSVVETLPTESVACDLSNLFADPEGADVSLAL
YNASNIFSDVFKLTGKKVVVTAAKRPLNYETLPNTVFIIYIKGCDPLRLCTTSGPLLITV
MDGPDPPTLSALPKVSISERAATGSVVSIASAYDEDRGQTQTLVYSIASGDPLGQFAINT
SSGLISVAGHLDVNSINFYKLVIKVVDSDGLYALSRPTFDVNILDYPDPPYFADAISDQK
YYQVNITQLLQGAKSYSSIRLNVADPDLDQIGGNCSISQDAASSFALQAQVDPALCVLMV
RPLVTIKVNTCYNVTVKVTDFRSDGTDQMYSEIMLEVALFGAIYPPKCADMNLNLVENSL
TGSWIGNVIAADGLGGSAIDYLVVKGNEYDMFRISDSTGELRVGTNISDFETANRFILEI
EVRDDTVLPLISTCKVIISILNEIEPPRCDQTMNFHVPEDAVSGFPVGDALWNHCTDEDS
GKRGVSNVFLFEFVLTMTADIPFTITNSSGQISVSSVLNYETKPFYPNLTVVIRNAKSYL
HFTYMSLNVMVDDRNDPPEAKFLNKGGTSEVSSIAVSENTGIDTVIAQLSLYDEDANEAF
NASLSSTTTNFRLDRVNTTIFNIVLQDFLDYEMRERYVISVIARDHADAVTRRSMNVVIG
DVSEKPWIVPNQRFFIEENSKESAPIRMRLSPRGNCDLPTPVMALLSHCNSLTSCMSACA
SRSNCAGGVFQTEKAICRLTDQFLQDGAACSVPCRDCEMFEMFVPTTRKALVYQDVSMTN
YSVLDAIATSTHSLSIKMPSHPYTLARVESWPSLINFTVDGWINLEYNEGSILTLYLKQR
NIPEKRAFLQWIYFGDTLKISLGRATLGTKISLEKRIWYHIATTFSLATGMLKIYIDGSL
VLQQNLPNSVLLPWVSGALDPELIVFGTCFDEYVCPIKPFSFWIDEVRWWSEVKTVEYLR
NAFTKVVTYPDPSLIAYHRFERDELFGKNYMHNVNSIVSNSTTSTSLLGNGAPVRGEARQ
YSLRWQLLVIQDEGIESFSISEIIWYSERKRLPLIEVLSNMTSSDGSSFDTLRAAIDNDQ
DTTYTFQTTGGNDTGASIELYFAQPVDASKIIVRSSKSQKHCVSTVAIRYYNTLQKSWHT
DRYLSGMGLPETNAISFAAADHIVADDDDTGNSDLKYSFADGTTDDIVRIFEIQLHTGAI
RLRKDISLDYERQSQYSFQITVQDSTNLTSNPSLVTVAVVDKDELPVVSNTSVFTVAENA
PIGRFVGSFSASHVENGNLVYNLTGGDIFRSENGSLWVAKAQIDYEFISSYELTISVSKS
KLDTNYATMTLTVLIEDVNEPPIVHNQTRFIPENSMQGTFVQGQLLARDPDTWQTISFMI
IAGNEEDFFTIHPSTGQLSVGQGPQNTFIGCFKMLKRNLALTNTTLPSGALEDCSTACKL
HQYLIIQRQFGLRCLCTNEEPTSPSEAMTDVSCDACCYRGESCGSTSNKYLSVYRRHSEL
NFEKKNTTNLVINAMDSGIPPLSSNFTVIVSVLDINEAPSLSLTSSIFVDENTNVLLRLK
GSMAIVQDEDTDDDYIIELIKCSPSPCFFSLNRNSEIWNIRPLDYEEENIHIITFVARDR
GSLASPPANLSILVHDVNEAPTFSTMQDINAIVDENTPVGSVIGSPILAYDQDLGGGVFY
TIMSQDITDCFSIDKVTGQLFVLSAGCLDYESLQFDPLSQLIQIKGGNSQLNVTAVRLLV
NTLDSETVQLSFNYKAAQESLTTGTSKNVVLSMLQDALAIRTPDEDVSDSLMIEASSPYV
GLENDAVLRGIMSIKISSSKKALYLRHKNSDWVRIYDASMLRKSIGITVSVQDWSSEALS
VQRLYRIIINDVNEIPILLSIEDISVSENSAEGTAVDNASPLNDIVKDPEGSRDLQFILQ
NQSVEGAFYIQNNSLMVGSIGINYESRSKHTLSVQVIDRDLYALINSDVQIRNENDAPQV
SCPQYQISETAALETLISETGVIVFDEDASDLTFVYQLLNATSTFRIDDLGRLHTKSYLD
FEAQSIYYVKVSVKDSRGASATCVAVVDIIDFDEPPYGSTIYNVTYHQDAKYGDRLVKLL
LQDPEQRKMTYSISSATRNSSDALIVLPFDVSEDGFLFINRTGGFAKLELSSYILMIVVS
DGMHTIKARCVLLGMVVTLTIACPTPSIRMEALENTGDLSLGFLKVIDASIPKQNSISSA
ELYQLVSTDKHTLSSFIVNEPSGELLLRPGQILDYETQNTYKLQYSATVKTYQTIFCDVS
VDIVDQDEPPICVSENIASVEENGPAMEYYVGKVSAIDPEGGKVSYFLDSHQSTGIFMLK
ADGSLYLQSQALLDYEKVPYHIIKVRATDGRNVISCDLTLQVIDTNDCPVFPELLSTGRL
ERSVFENSAAYTFIGSPIASTDQDHATGTATPSTRIQYKLIDDTGTFTIDKTSGQITVLS
GESLDYERVSLMIVDVYATDDGVPVCTSNASVYIHIIDVNECPTILSCLTGAVDEFVPGT
SQKPSEVVAQIIANDVDSDNLLFEMVPSGNSSLFRVDQTSGLIFATDNRAFDYESIDKYT
IKVRVTDSIGLSTQESIDISVKDLNEPPYFVLNTASVFENSPVGTVIVNTSLTPIAIDPE
QQPVKIFLLETNESNSSPPFIIRQEYQSHCIVVSRDKILDFESTPTYDIMLKVCDPANVC
SISIFKILILDVNEAPIASTSTFYIRENEIAGVHVGEPIMAADPDVGQFLRYSIADGNKD
GIFGIIESTGQLMVRRSAALDYEAKSLHILSVKVEDSGHPAQSTQTIASIIVQNVNEIPL
FAINQTLRIRTLPLNVSLNNAHVPSTLFEWSQITSARFYYVVEAILEEFSKLSGDFSGYC
IIDDFHTSTDNLQGQNLCPQGPATPQILTLTWNILLPLPTAFAVRIRSVDKLTKAVVVID
SISAEPTTQFYGNLYEEYVQQNIHRGAHDIFIYVIASGSDPITIELRSGDELWRTVTKSS
ISSIGQETLSRSIAEDKGPGSLLGHPLSAVDQDSDSLEASTYGNLTYSILQQSSPAQFEM
NGDNGQIFLSAHAHLNYEDTQRYTILTQVRDSDPVSPLLSTAWVHIDILDVNEPPELPTQ
ISRSVYENSPAMTIVGPPLSPKDPDGIIEHFKFRLLTNESSPIFSIHTHSGQVLVSGGSG
TNSVVDYERQNQYSYQISVTEEGEERVTYCLLIIDILDVNEAPNFSLVMSNTIYENSIIG
TVLMQIIGNDPENQTVSFSYRSTLGDGEDDAFRITPTSYTSANFEVLHANLDFENQSIFD
ICVTVTDEENFGIDRVVHGATGLSSTQTFTVHLTDVNESPKLRNATRIPNHVSLSIPENS
PSGAVVSLQGLKSYFYDPDENDQLTFKITSSVPRTDMFVVNYASSNDAILTVLNSSLLDY
EQVPVAHLDLLVADTASNTISCDVEIQITDVNEAPYFSPSALKLSILQNISANSVITYFN
AVDPDNREFTILYDIIWSSHPMQFSIKNMKCLIKTNISNSTTLLKQDVYRLQIVAVDEYG
AGKASRNALMVEITVVATKNPPILDIIQLNIPEDVQSGTKVGAVHAKAESDSVLSFSLVP
NSKRFILKSLDALSAEIIFIGSASVHKFALDHETEPTIEFKICAVDTFSYMEGCSTLSIN
VTDVNEFPLMDGYSCQLLREVEESFCRWDSEELKVPGGYFDGNTSFDTGSVVHEGSIVFG
SNLDYTLSVAIYPESSGYSNIYELQCSDDQAKDASTLNLSVLGNNAISLMIVEPQSTLSI
ITAPVVALRQWAYLTVIFTFSNRTARIYHNENLMGTNTTLVTNDYSADSQQWLTSSYAVL
SRSSAPFRGWITRFRYIGSTIAVPEQLAQIIAHPVTIFHVEATMINASIRELHDYCTKQG
RHYCNTSERVSIVESNSVVGNHSKLTPIISGNIPCCSDPGQVALIGSSKSALLRSSAVGA
SSYLGNRKEHGYDHHGLDFARISPETNTTDSWCSGFNTSDDPANYIEFSFPEPTMITTIT
IASGLNSITCMPSIVTKFKIWYRSSPTSPFIPYDPRAYSIGWQSSQAHASTASDYILNSG
SQSNTNSYNVSIRNIIAAQLRIIPISWMGDAACIRIEIYSPLTLLDVQHRLRVFDQDAEY
GKDKVVFRLEGSAQALPFLIDEKTGQLRYIKNWINRQKESNYQLNVTATDSHGLSDFCTV
DVNVKSVFKSPGKPETGPIFRISENPLPGEHIAYYIPVPSNPQEKVNIYIRNRIPSPAQA
PCPFTIDHVTHALRVRDPEMFDFERHPFLKCQVLLVNDARFPLSSLQTVMVEVLDTNEPP
VIPPNQQGYIAENASAGTSIMVVKCVDPDANTAALLSRPSWSKLQFYLANSTIFAIDLFT
GALSLRSSFSLDYESQRQFALNVLVTDGGYLTTEATIFINVMDVVERPIVNSSYAVSVPE
NGLVPRNLYAFDTTDPDSISNQFLRFKIIDACAGEAISIGYDTGLLQLDSPLDFEATPTY
HCKVRIFKILETGEELGSICELVVNVEDINESPVLRGSTTVVFYIDEGLASGTIIGSALS
AYVSDPENDTITYRLTSSYWSSFFDLDACDGQLRSRDSFDYESNNIDGIYLSVLATEVRT
QNHLATSVNVSVQILDVNEPPLFFAPRYSFSTSENGLSRTSIGSLDAMDPDRNDTLKFTI
APDGPTTIPFHVDALAGEISLLDGIRLNHERMPSYIFNVQVTDKMRLSAATEVTVNIIDV
NEAPYCANMTYVSFSEDAAIGVMSTGALKAIDSDVSDEGQTIYYRFRNENGLFTIEKDFV
MVTAELDYETIPSYDLVYEACDEHGACSTDCQLKIKVLDVNEIPLVSDASFQVKENTAAG
AWIYTIKTAIDQDYGQTEALTYNVHSQSIHDCIRIDGKSGQIYVLGAVGLDYESLPNHQA
WVRVRVTDNGTPPLSSYLTLNMVVEDVNEPPEQIFGSLWTVSVPEDLAINSTIFIVPVVD
PDHGQPLTFRILEVSGGNSLTQITLSNEMSPDLQLNQPLDFETMENTENHVISINLLVCD
PLSLCITDVISIAVHDVNEAPMFVKSNDTTTSTDWLSGYDDFFFHVGKYAKKGDVVGKLH
ALDPDISDILTYLISSSGQQHSDLVSSSNMTIIPCEVAFGVDAASGEVFVDSVALQSHMY
EVDGENVKCIMYAAVLDRYSLRDTAVMMFELIAENSAPVCENASNKSSRFTFYVNESAPV
GTLIGIPLVQYVRDADLGTHLTFHLEHSFLAVMRATGQLYLSAYPNFDFEMLSGFPNSSS
IAVTVRDDGRSHDGRNFLQTTCNLEIISQDVNESPKTIPSMSISLNEAQSSHSDFQLASE
AFTFFIKSSRDDFDVISTGGTNTTISFDDRTLFMGYDAFTQHHSQTVLIFRDLDFQKRED
FLFLENVRLDFNVPSGQIGPFSLKISRLNADRLHEALENGPQTAPTNKNSTDTFLEWTLS
TRQFTRNIQTPNLARLFASGQRNQTSSWISMNAVVFKIEGSGVGEVHSFDSGSTESPSVT
FQFSLANRFEIPNAVVPFTDVDAGDEKCTRFTLVSGNPDPNKLIFQVNPKTGQITTAMQL
LDFESRHQYELKVSAEDKDGLQSVCVVFVTVLDMNESPSIEEMLCFISEESVSVGDFICV
AKATDPDTITSRYGTISFQIEEGMQATTALAVDKVSGVVTVANASVFDYEKFQKLTDSIC
VVDGGYPSLMDCNKIDIIIGDANDAPSVIAPTQCYVDEIDYTLTESERHLFTDKIVCDLK
VQDDDIGSSVESSWRIHNFQTSTTQEESCPFGLLLNGSVIIKYPAQIDYEQLATCSLHVQ
AFDLGGLISPVQSVRIDILDLNEPPTIMATRGKSHVVVSIPENSAMGTIAGQLTFFDPDL
LPSGDPDTVSLLLDKNTSFRMQSNKFGIYDNRIQLLESGALNYETTPLIVLPLIAIDERG
ARSTPINVHVVITNVNEPPSLKPHYSINVNENEPSLTIFLPAITATDPENDTLAFSIIYE
YCMEPENMEYSPSTKFDIGSLDGFMFKRSGASIDFESCRRYVVGIRATDPGLLFATSNVT
ILINDVNEEPRLFLDSYRSIQLPENIAFPSDLTKYLPALHEFVYDPEEMIETYSFEIIEG
NDDQIYFINPSTGQLSVLRGLDFEMKTHYVLSIMVKDHGGLKAESYLFIEILDVNETPVI
EPFTLNIEENSLSGTPVGTSLNASDPDKNSIIMFRKLDTTNSHCFEVDTIGGQVVVATGS
GCVLDYEVEHSYPLTIEVTDGELTTVENGKVNLIDVNEAPQFQNFDAQSGLKEFHVSTLP
ENALHGTLVTHLSATDYDKDDQLRFYDCGETSSDTFSVLQISPNMAKLMVADQSNLNYEI
QSVFHVDICVQDRRNLTDQVKVVIELMNVVEAPFFIQERLYASVAEDAREGDLIGSGLSA
YVLDEEIRYLLSFHAADYSCSSPLLTSNFAIVNTTCGIASQYYTNVTTAFSIDPFCGQIR
LLQGDGQIFDYEAQMTCQIVVNIKLDDGAESRSNDCITLEVTIIDANEAPKFSQSVFTFS
VSEKTGNNSSIGFIPAFDPDATSSFQTLTYYIESLAADALIPRSHVIYPFEVLPNGAVIV
TNKDEIDHEKQRSYEFGVGVTDHAGLRHSTKVRINVIDENDPPGFPRTNYVYDIQENQPA
SALIGHITAIDEDTHQNKSLSYALVNADALETFMISSVNGTGVIFLKNAASIDYERQQVY
SIIVSATDNGAGFLSAFTSVSIQIVNVNEAPQLQGQIAFIAEDALSLSYLYSSSNFSSIF
KISDIASDPDENDTLTYSLNDPSKFFLMQDTKTGTVVLNERLDYEKQSVFTMEMTARDTK
GLQSRANLVVNILDRNDAPIIFTVKADVGVAFSIAENSVQNTIIGKVNVQDQDQNQNHVF
NLDQTTFELPNGSAVSGGMNKIVDLHPTSGVLRVWDASIFDYEFIRNLILQVSIFDDGAP
RLSATSNISIGITDINEVCNFDTTHLLYQIEENRASCIGTMAVYDPDLNSTSGMLWGNLA
YFITPKMSQPSSGSLTINEVTGLVCVTLPFDYEQNKRISIDARCIDGGGLSCSAPIVLEI
LNVNEPPVIISQNAFYVSESSPIGSGLSRTKNMLTFGASESIGFWDPENDTMNLSQNTTL
DFTILPTSGLVRVSRQLNYEQVSLYEFVVWAKEVREDGSSALHTNTIVQIVVLDMNEPPL
FHLVQKPFYVDENTHLDTYIGTVAPAMDPDVHDQICYSILDTISLSTGISQDIFTMHSCD
GELRLKYSNVVDHETTPVYNVSVIATDILGLSNVLANPLQVYVNDLNEAPLCRDTKLSVL
ENTAAETLLYSLNWSDPDSTSRNRIANFAIIESGNSREDGWFTINQLNDTHFGLFVTAKA
DLDYEQQSIYTLKATIEDTFTYSDNSNRLTSSLSSICTIQIHIEDVNEPPRVETIHTRYV
DENSPMFAVISPPISASDPDAGDVLTYSIKATQSGISTISETLFVIDSRSGTLAVNGVLD
YESQTTYVLTILVNDLANNTVETKVTVHLIDINERPQLTRNCVFNQLTGVVANQLDENTH
FCLYADENSEDATLLESFAARDVDENSTQRLAYSIVTTSTSSASILNIVARVNQTTDRTC
DLLLTTAYIALDYENKSMHSFMLQVSDAGSPKLSDQMPVLLFVNNINEPPALDPASVAHT
VISENIPPGTYVTKLRGKDPENDPFSFVLIECQPVNDTVTISDRGEVHTASNCYDYEKTM
ALSIRGMLVASDDSGFFVPFEFTIHISNMAEPPYFQHHDHFMAVNEFAGVSTVFGVVNAH
DVDRNDTLEYSLNSNGSMFAVNSKNGCLYVARSRQFNLSLANMYTLNVTATDSTQLSAST
KVHVVVVDDNEPPICPIINCWIVENSESVYLGLVGSQAPCHVSVTDGDIGQSHTFQLLSI
AGSTALNDDAHDSPFLLDYNSGQVRTKSKASVDFESKNYFRLRYHVSDVPASDKTSLSCN
NDLVIMVVDTNEAPISNSEQRKFSITENVPQKTVIGYIDASDVDYNDTITFELLSVTIPA
DPVLINAKSGEISVYNSALYDYEGNQYAFSIQVRIRDREGLQIVSEYRIEMINTNDPPII
PQISEVTVYETLEVNSESSTSQRISQHILQYVTTLPCHDEDTGDHLTYRISSTDGIEPTD
MFTVEASTGRLHMNAKSINFEVKRQYVLTFACSDGIVEVQADLSVRILNVNERPSIADQS
FRVKENTADGTCLGTIQVQDPEHDDRQYLTVSKASSFDGAECHVGRLHVGNSLFTDFGDF
TWSSIPEQWLDAFVLLPPTKSSSSVFTSNMSVRIASKGTLLLMYDEDAIQIPSWIKEYGF
EIFEELSDSTSPISSQLAAQSSSNIMRFVVFTKVIEREGVLEFPSMAASSADLAFIAAIP
AALKYSLSQHDFQTPQIKSTECSEIDYESLALVHRVETIELLVSLTDIGGLMSQGLLQIH
IENENEPPRMNIAEFEIAENPTKGTWIGTLSSIDPDFDDSLQFSKLCACPDIHVSPDGNV
TVAGIKAFDYEVQKYFNILVRVTDSFGATDETTIRISIRDLNEAPIFESAKYEFVLKENS
PDGTVFQTNPLRASDPDFGHTNTLAYTLLNVGLGSIPFRLDVSTSHLVIQQSELLDYEKT
PEFIFAIRATDIGFPDAISATATIIVKLLDVNEPPFFTPIPLLQIKENTLSGTEIGQVVA
LDPDISSVVSYKLMNASNWVHMSPNGSLASKKSFDHEEFSVLYVQVSAEDDGRNCSMSKS
FDISGDGSICEKLTVLTVMTVFILNVNDPPQILPSSFSIFENLVPGLDFGTPLAIIDIDG
PATKYTITSPVNGLSDPAFGLSNMSEYFAINSYTGQLRALISFDYESQSLYSINATYSDG
EYVTFTVIKVVILNVNEAAYMLPHSQTGLVRENQAIGSAVMQIKIMDPDKNVTDMTRNHF
TLLDSATPFAVRAELGEIYTTKVLDYERDVSLYSVTIRVCDDVVSTLCSDGYVQINIVDV
AETPSLPLVHCSIIENTVDLLNADMTSPCKVLAEDPDKNPSFSYKLVYTATDIQLFYLAV
DRMIINGTGDSSSQSVGQKWIDLDARYHTRDSVTVFVNQTVYLSNRNGSSTSAQALNHEA
KSVYTIPIIVYDEFYSFNGLYCASHIVVTVRDANDCPTVGGSVISFSVSEIEAHTERNKR
LQLGYPIPALDEDDEDILEYNLASPSNASSSDLFTIDPRSGQVYLSRIPHKFEMIFPLVY
DIAVVITDNGGNSEQTSSIAYNQRCSIVVPVRISVLRANIPPLWLGTMPSNFTIKENVQS
GTPVEGSASSRLSDFVIDSQAIKFTLLSKESRHCENEFMIHISTGEITSRWNNSLDYESN
SLYYCTVAACDSFDSCSNIEFSILVRNVNEPPFFGSLSDASNVVFRITENNPRNIAVDRC
LGANDPDRGDVFALRYSIRCANQYMCDSIFTLQTEKDVALGNCARLILKKPIDFESESHS
YTFALVVQDPYGLTSSLDVRVEIIDINELQWFDAFATTASVPEDAEINRVLFKISAKDPD
ILTPLYSTMTYTITSIYPSGFDSWFRIDAYTGHVYLNAPLDYESIMEYQITTGASDESKS
PLDIFNTTRLIVLDVQDTSIDDVIIVSSDRKTPASSLMLNTEGGEFVLARGTNIGFKQRM
GSDVMVENLTLQYTKYGSGVMYDATNCSLVLGNTGVICLSSPGAGNFLYWKVTLTMRVPR
LRSVRFTATSTVPLLSYDSPTIQSVICKSRFPTAHDAQIKNIMITGSNFGHVGMPSELIA
LKYGNGTFSARNCSLLKQNHTFIPQRQTLECSSVQGSGQGFSFVVAISGQTSNEFTPGSE
ELCYYEAPSITSIIPSGALSTIGGDRVHIFGSGFGSATFSIHRTISYSNSVHKFEITDCM
ITRDHMELDCRTVPGSGNNFVWRVVVDGVSSKAYFPREDTLLSYAPPKITSIRGFSSLST
VGGTRFSIEGTNFGPDASLFRDPVVEFTLGHEIIYTPTNCKRHYMNGDLHNTLECISPSG
TGTNHLWRLTIENVTSGFHIQNTSYAGPVVTKVFRPNGTSVLQTSGNEEIIISGLNFGKK
NVSRINRVTYGVLGTEYLATNCAIAVDDEWIVCNTVPGVGTGLSWAVTIDGLTNTNPTIN
YARPYIISIDGAGSANASTFGFQEIIINGGNFGPSSINFDAITYGLTGREYEVESIISHN
DSTIRCLSRPGTGMNLRWIVRVGGQSSLLSEAYTSYGAPSIKSSSSSIASTNGETIIRIS
GHNFGANITESGCIVVFALPLEMQSFYKVRSQVLSIIFWEFSDKQMEILTVKIPMGFGLN
GFISIQTGKFLGIYQQSELFTISYDSPIIEQVYTDEGSPSCAPTCVTLTVIGTNFFTSGT
LLITKTPVTTSDLISIDSRNVVSRTDQFIAAWSHNSVVIADYADKTGYVTILLGNGILSN
SVAFVWSCPTILDWYTLLANCDATNCTTSFHLTGDTSLYRVQPIFVVGSYTQQSASIGGA
TLNLYVKYLGSSSKIKVNIGPFAQCTNIQLTTPALPPSRLFTTGVTDVSGITLLTCTVPP
GQGSSQNLVVVRGSTPSAIRFIDYIPPRADWNLTNAYTAPTQGRVTTLIGTNFGTDPVVT
LNALRLQILSHSHTRLDVIIPSGEGGGHKLSLIAGNQLDDTLFSYRAPVVYTYTTTGNST
EGGDEMRIKGANFGSLSLSHEHSVSFNSTYSCHILSLDHNQIICRIGVGQGFELPIVINV
SGLTNEDTMRNATFSYGRPVISNVSRSTGPTHGYTCECINSPDRPCASKRLPVECLSQQI
GSSLDGSTSGYCIKANISSVSAVHTDVTKLPDIFSGDMPVYAGSDHPTLLLIRSLNTGKW
KILRDDALWYQSNESSLTPPAHGWEGRFFPNGSDIEVTQGYCPGHVSMVCPAETTRCERF
KITLTGRNFGIRNETWSLQLIPKSTNTSVLETVDILDKDVILYSHNIIQFSLPPGQGVER
YLKLTISDQSMLGPDIPFSYEAPKLLALRTDTDNLTTCGGFFISLYGSNFGSRRSKVLIG
GSEARMDMKSSHPLACDVGACQYSTSGPCLDADNLVCYPSEYDVIPRFSFKKSCPSPAFQ
TLCTSPNSGDLSGPNAMESFDFHSDYLIRTIVPPGLGNDIPVYVIVDNLSSNALRFTFNQ
PVIDSQIPNLADANSANTVEIRGSDFGCYPNRAITLGFSDNDGNSLVANRRLSRQDSSEM
GRLHQNERKLTTSSNFSETNGNITWKSANSIVWKTPKIKAGITNLMLNVGGNIHAAKSQT
EIRFQCSAGYYRSEVRFCEACPPVARCVGGDSPPQAEAGFWREGEHIFVCDPPDACLGRN
FCGEGYMGIRCNECKGGFHRLNGGCRSCPAQKWVLMVVVLLVVSVLCVLSYFLSRKGVSL
SLLSIGIDYFQTLSIFGNTRLQWPNSIRIAFSSLSVFNLNLEIIAPECLSVPVTYRMKWI
GIEVLPLALTLISITIFVAKYASKRYVQGRRTRLTTHKPLLFGFTLLMLYYLYLYLTRTT
LDFFNCVSPIPANGKTYMVAIYAQCFQPGGLHLNLFPYAVMSFLIYTLGYPLFIFYTLYK
NKHLVMEDQLLRAMQRGTTRKTNPNCWDFRKKYSRLYYQFKPRYWFWMVVIIIRKFLVVV
IAVLFRQHPTFQLAAVMLLLLLNYAFLVRNRPYMSASETKKVVEDYSKHVLHEVRLAKLR
GDKYIQPAHLRLVDRDEIVTQPTTDFRNNQNKSKIDESDSGTSKDGSEQFVSSQLMKRFS
KWLTHKRIQSTFFRNENKPGAMPPTTKTGHTSTVKLGSTTLQPTFSTENLWDHNSVDATL
VFSSCLILLSGVMFDSGQLGSEKEGFNSVPAQLLSAWTILLIVSSCAYFAIVLSTELLVA
LRPDLYEKIVEFRISLSTSKTALVAAGSSTSTSVSEIGKRDRNEEREANLYRPTTKDDGE
DCLEMVAHMTANPLHRRKNPRSSTRHAHNSVKQDRSLSISKIKSRDVKRNQGRQGSTASL
RELDARSSLDSAKPLRPESSIPPVSESSITGHAGLETMSQDISSSSEFALTPAKLDRHKS
LLSTGEKKSGLDTPTLTSGELEKHSTQHQNTSGAPRDSIEIERIIQDRTVDERSMLREAY
ATLPPVPLGDVIQEVRPIRSILGRRRVRQHQDQMRVEESLDEVIAASDDVKVPEDRDDVH
Download sequence
Identical sequences F0VYL4
CCA13878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]