SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA15276 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA15276
Domain Number 1 Region: 1674-1964
Classification Level Classification E-value
Superfamily BEACH domain 4.19e-119
Family BEACH domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 2079-2336
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.99e-17
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 3 Region: 1555-1647
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000032
Family PreBEACH PH-like domain 0.019
Further Details:      
 
Domain Number 4 Region: 222-386
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000353
Family Clostridium neurotoxins, the second last domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CCA15276
Sequence length 2355
Comment pep:novel supercontig:ENA1:FR824055:50325:57498:-1 gene:ALNC14_014190 transcript:CCA15276 description:"nucleotide binding protein putative"
Sequence
MSTALSDILTDIENGHLLDANLARDSPKKLEDLLKLLFDIICQVAPQYDSKLFDLLHQSI
RLYVQNWTYTCTSIQPEISYKSFLSSDSVNFLHRSQLNSIHERIKSHRTFTQSPNSTSCI
PQSQNCILKAIFDTVNTLNKNGNTNSAIVEHLIAPLREIITLSVNTSEIIQLFQAIRTSR
SPARSTLLDMVSTLFQSTCEPRGIFIMRGPHTGILVFIQMDPPSSVKKGYSFSVTLKSDP
EDAEIVPIITLFGINGQGLTIYIDRNEFVVRCIGNPESLFQQQQLRFPFEAARKRSKNCW
TQLCVVHARNILFKDKWTLYVDGKLYFSGNLPYFDPMCSPKNLFCIGIALLSTTIHRFQG
QICNPTLFDQALIDTEVEKLHNFNAESDTLHPEFLSARQLFCFDARFTNLKHHIAFDTSG
TQCVGILEPDTHPIVTNTVNQAMEGIGGCSTLLLLLLDQNPNFIFSADEIGKLLQAISIG
LDSNPASRWNFIRADGVAVLAVVLESISPASLTRLILQNVSSILSHLSAASTEAQMARYV
YQIFFAKTSWFESPLETQKMLFGEKLPKYIEIIQIWRTQRLLSTNSDSKEADATLTVNTS
FLCALLEEVYCSESIDANKERSVLRRLLIDHVIDRLLFPKHGASDSDEWKQLLAYICSVS
QTRPSKSIVVEELLHYIANCLHSFGPNSGSRQTLYANILRISKGTLRLWWEPLHSPMASV
RYSGLCVLEAYALDKVMFHRRDTLMLHSALSMRPLDMASVEIVINIVLGRRKSLQNQTRT
TRTVKSTRLDMIPHVLVAMCSKVDVNLQALILLEIVAVMESDGVKEAIRSWPQWLSRLLA
LMHLEEATSPVERTEESMRLCSLLGDTSTSMATKLDTIERIHSSSNQLDAEVVIESQFDA
KYPFEFGRAYLQLAMDLCPGRCRDIVRKLAFQLIIDIAADALINAEHGWLIALELYFHHH
QDISAITNIMAAYSEKLTPQLRFLRADNSIVWGNMTQFAALITHIHLHFSKKTSGSELLR
HAASMWSLVLPHIASLDWNQLNASMAMSTEVPQESVPRRLIANLSQSRSLALQIWTQYIA
FEPSLCDAKAFQVPLEHLRVLEPDCRTYDWLPTRSIDLHIFLVDVCFSILTHEVALHVST
RQCIFQVIVQLARTALQSKHFDDLTEVTLIKAFQIIASTDLSFFTNSKEMEELQALWRWQ
LDQIKGEVDAAKNSVTRGLSKQNAAFQTSWAAFIASNAGGEFNPYVVQEDVTLRASILSD
EMAACEALWVDLATWKDTFTERMIRKRNAYQTSHLLSSKRAAERFGCSIQKLSTPCRQPS
ESLRFLYKLGRRETQFRIRLVKKVAEDYRVSAPSRECDMESLGDSTGHLPRYRVSLDRRS
SHENEGGWRSETGSEYDLFSDAHMRAAILKSSVGKEQQEQAFEEISSEDEDEMAEHNSVV
KPAMTDGQGMAQEAPDRDQAPGSSSFGASVMNLVGGVAERVQQAARDAKEVVDFQVDALY
TARDVISDEAHSVFQGVSTIIDNATSPKAAPTRDADKDFKHEPASASTTFKQEYRVDANL
IHHMHIVQGQLVLTASRLHFHPMYVIDEHGNVIAEQGASEWRFLLKQRRWEVDDIVTLYR
RRYLLRANAIEISISSSRKNYFFTLAMNRIVPFFEALMARRPLLLRKSPMMRRLRLPSSL
FRNSNMTFRWTQHEISTFEYLMWLNTVAGRTYNDLTQYPIFPWILSDYDSKTLDLSRSSS
FRDLAKPIGALDPDRLAFFLDRCAGFEDPDIPKFLYGSHYSNIGAVLYYLIRLEPFTSFA
QSFQGGKFDHADRMFHSIPETWRNCLTDPVDVKELTPEWFYLPEFLVNCNDCDFGVRQNG
VHVGDVLLPAWAVSPEDFIAKNYAALESEFVSQHLHQWIDLIFGYKQRGHAAKAANNVFF
YLTYEGMVDVDSIADAVVRASMRAQIAHFGQTPSQLLREPHPLRLGIPEEMVPKAQASNT
CRMTVLRVPHNVAIRYIRVTQSAVLCMDDHAYVSCHRVVGKHTQKSQHTSAFFQEGPSKV
SSPSSRLPDREHTLLSLEFMELHDRKSHKIIAWPHDIPSPKNLAFLDGNTVFCTGGHYDF
SAQFHSTADGSLLTRLLQHQSVVQCVATNVSGTLLLLGCQNGTMSVWKTTETSSTRLEAV
KMFRTGKGRPVHAKDYAADQVLLGHNAPITSITVLEEAAMCISGSENNVCLAHHVWNGSI
LQEYNVPGHQSPGIVSLAISELGHFVVQSLGTGLPMLYTFHWNGSMMASLDLHNTIMDSV
DICARYAKVIISNSKEAAVLTLYTLKDRVPVPLSDYHGNISAQAISRDQTHLILGTTQAK
LIAIPLFFACHYKAS
Download sequence
Identical sequences F0W2J0
CCA15276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]