SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA15386 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA15386
Domain Number 1 Region: 3498-3616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000952
Family Synaptotagmin-like (S variant) 0.095
Further Details:      
 
Domain Number 2 Region: 1275-1365
Classification Level Classification E-value
Superfamily E set domains 0.00000178
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 4178-4204,4289-4340
Classification Level Classification E-value
Superfamily E set domains 0.0000056
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 
Domain Number 4 Region: 694-772
Classification Level Classification E-value
Superfamily E set domains 0.00000624
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.096
Further Details:      
 
Domain Number 5 Region: 3776-3847
Classification Level Classification E-value
Superfamily E set domains 0.0000118
Family E-set domains of sugar-utilizing enzymes 0.058
Further Details:      
 
Weak hits

Sequence:  CCA15386
Domain Number - Region: 1881-1955
Classification Level Classification E-value
Superfamily E set domains 0.0191
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number - Region: 17-88
Classification Level Classification E-value
Superfamily E set domains 0.0649
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CCA15386
Sequence length 4777
Comment pep:novel supercontig:ENA1:FR824056:39902:54353:1 gene:ALNC14_015290 transcript:CCA15386 description:"conserved hypothetical protein"
Sequence
MSKTSTPRTRTIRLFLTDPSIAAASGGCKIAIHGRGFAGIAQSLKVTFSQPELDLMKNVQ
VNGTYRSDTIMECILPDFTQVVNNFLVKCTQYATSTDALTTSPYLVPIDMFVTLGDCISN
SITITLHQEISILKVSPEYILMSTPVSICATINLTKQGTDLSQPQFTTNKGETQKLDNIT
ALPVYVRVRSNSTKEGEASCEQIRVATWEVSSKGVYKVLFVAPLLGIGVARIQVSFTKTL
FYPNDEVSLAGSRQYVVHNEVSLNSVDPPYIVYNPGKIPVIKIRGQGFVDSGEISVHFQQ
DNSERKQEKRADNQKIEQTTKAKMVGALHSAGEIHCTGLQSSFGVTNVYVSFNNGRQYSN
EMLSILVCRERKLLGNVPRYLSLKGDALVKLYVTRLPSDHIDCWGRLREIRPSSKLYLEL
QGANSENSPIQILHKRVPLNFSAESYDALNTSGPVIYQFQYPSFFEKIERLVEVDRSLSD
TDQCNNSDRVNQLFRNGLITFSCSVRYGSSLLAGDFDLESYIPPAITSVIHQHGPSTGDS
SVFISMKHQVPNNLAIIVNFQSAFSDLSETTPGVRSNLSIHGRSASEFINQSSRIEMINH
SSNYGPGHPDYTVSCSSPSWNLSSDQNSHLTLVQISYNEGYDFYPTMTRSNTMDKTSILG
WKLVLAKVRSIGKVDTVREVKQDLTFLQFLYYRNPIVSMITPLSADQNGGTMLSLRGSYI
IDHGHIAIVRFTSQELSKCVTGTFEDGQLRCITPPFHAGNADISITFNSEQYEKCNIPAA
GTSHRSHFLYYVTPSITSCRPRCLCAHKQSILRLYGTNLVETGAITLSLHSLSTDCYKKS
SRKVELPGKIEGGAIVWKSPLISRELTRQNLSISIALNGVDFMNTEISLYCFSSYKIIQA
DPKVAVRGLPIMLTVYLDQEVVSDVVLLRLELLCHETSIVHSHGPMQAESWEGNYIRFEF
PAIDNIITPTQRLISAHVAISFDGQEYYQLGDLLQHFEVSVMPQVYNVRPLCGLYQQDTL
ITAQTHDLKKFADKLQLYITLEMSSQGGILNTGFVGHLETSLRLSSDVGGMLTWICPSLA
KVFSRNSNTESAHLAVKSFKEESEQDGHSIVLSPRLNIQLCVNEGQHLGPLKSFRYLRLP
RLISMSPSIGFVTPGCVITLEFREELDHARVLFRFTTESSKADTSCGVRDEDHPRNVLEC
RTPHLVSGRHTISICLNGQDFSQLRFYRPGKMESMKDDEGGASRNTDDDPETELAHFMAH
NVPIHKEALSSSKNIIGSGTVEGQTTIRIHGNEFISGHPVYVRFYAALGDNDRVCGCYDP
VEAKLIDSNTIECNSPPSSVPGLVEICISYNLQQFTNTLLYFEYHLAPIFKNLGDECGSA
KGGTEVVVTIENEKNGLPTNRSFICPVFRFQSHGNGCVRHIRDVTALYDNLKHTMSCITP
AWKGNALVQIYISLNSHPFTEFLHTGIYFVYYDHPQGSMKLLPAAGPITGGTNVLLHCGD
ILDADEWMVKITLDAADGKNESSVGCAVERNISTTCDEKGFVHFQTPATHFPCNAQISLY
VHGINITFAHARSLHFSYYLSPIVRQISPPWIATDTAFAEIVLLADHIQDFGCSILARLK
THGTGKDSDSETSNALSKDGRRNEESITGCIVVPAQADCANVQDDIRRERGRALVRCNLS
DIQIIAGYYEIEVSLNKQQFSQSAYTNANVANYSGLPCTSPNPFRVFSTPFFLATHLGPM
AGGPTVTLHFSKRVGYLLAKESKCQLQFLPISRMKGESIKAIEVEKSKVDSPTALYVQAE
IDHKNARIVCKAPSFRNICKVEVDIIMSYASVLSSLATVNRVNKNELTPSLTLPPPGTAT
CTVLHMFGSKEMDTYCTYQSPSISEVTPSCGPTRGNTLLVIQGNGIIDTGQLFVRFRSSS
NERDLVLVPGRVSHSFPDGAPSKEPLITCETPSISWSECPLTPTNMENPFFQEAPIRCLG
RARAHTSILLASCSLHRRNEHVRKSGEAVHTLHLTRVEINRSTVQKSKSPGSPVAKATTK
AGGIPSKAFTLQESSHLVLVDFTLNAGEQFITHSVPFYYYTEPESSTIKQSPRQFPSHTT
NRCGFVNRILTLKFSPQCYPSALHENFGDRIAFWFDGLPTKITSDLYDTSNILHDNEMKC
HLCTFQSSHRKGTYNSPIKSWMPRPSDVNEASDTKKSMEKSLRKRDDFVNSPRIRPHDRT
KPMYYIAASSSQAQEIACIVPEFLETGHVRVFFSFNAQQFIYVGDLGIHQPLYIEQHEAY
RSCSCLGSENFRLKSSLSSLLYSIPAHDISNQASLNRKRKSMNNVIRSRATKEMLSKEKE
LFSSDARGIQLNTWRKKTYQEIRVQIALAKSENEYGKEKEFQKRIVVSVCRTTIDHVISS
KTVDEEGKCVFESSDWTRDIHLRAQVILDPVCSQASFTEYSASYAEFYPEAQPSEIDDLA
NGKNHPIDIILLQRSTLYARNAARPIQPSLHIALKSFSADQDSSRFDVKLVIAHENSISL
DDLFNHSGKNNEIFCRKESYNDAAIDSVKLDVSKLPSSSFVIGVAFRFDSPPSELNWLTL
KRDLHVIVFDRCTTFAYFTLEKILIPHDAKADVKSCIWIVAKGSVADKSSLRLLKLDEFR
SSWTNLAEGGATTTSGEVIVDSVFLNDSSLPSREQSDGLESIMVQFSGSNALSKFSIEVP
GTLILPEQSSLSTLATEEQKNTTGDELIEISCVPPSTLSDGYVSVLIVFQGVRFSNTLLY
QCYDPRKWAVRNVTPSLIVHGSSSALLRLKGDQFIDTGKISARIVDLTQSQFLDVRADME
RTWSIYIRSVCVRQATDPRLSDCGLAKELSNSTGGGFGATLVETTPSSVRMAATSIKNSA
LRRLELVLSITCGTRKVVSSSSREVNMSMEGSIIDLITPTLFWDDLFELQADDLDQSLII
SLKVKDGVNSCGSSTGTISELSRSILSIKDLASNELCQKTVPMHEYFKPLLAVSNTQRYW
KSSLELDLAVQLSLPLPNSSCISCRPDLSSSSINIDPEFIEPYPLYVQIFGENDYLMSAD
TRNVEVRAPDTDSSNSDYAVAQGSTVYLYRFPEIHETTPCVLPRSTGGYLCIRGSEFILK
AQENVVIRLFGCKSAPEDENDILYPTALLESINAIRQPHDGTRDFLIIDIVGVVTSPTEM
NCEIPARLSTFRVFYRISLDGGITFNQASRASQFLLFSVDKIDPCAGPVTGKTYAALCGS
NINACLSLLSPWMRIAHVRLKWMKNGRELERKVITAEHYPPEDVVYFHTLQSRFRLDNLS
LQIELCLGSLLQSTPIKQDLTLESSSSDEIQKMESTPWKFSLDGASFYTYRSPSIKSVNP
VVNLLPGITGLEMVVQGLDEMGISRLSHLFRARFRCRGQMQTSGLALHTGGKLSTIIPRF
NVRNALSVELVLETSKHKTHNKLLRLDTKFQDREITSESDYQVQMYRVNSTVRKPQRLKA
NYMKRSEYIPAAKSLTLWTRKSGLMISVLRGRKFRPPEKGTCNSFVIINCGKKQQLRTTR
RDGSFDPVWNEVLEFDATCLDTAHDIANDGKPMQEVMLYISIYNQVNDQHCETLGSVDIF
LSRVIGSFAFRGWFSIHRSSSKYQSQKINDVSALNILPSGSTPNASQNFGMLELSIIFVP
QDPPKRSYAMQLAASKTLSSASKSHSRSPSTFLKRDSELHTAASRLNNQFVPARVQTANK
KENKGRNISDNEQLARIFTSNLSNLSAAIPTEISAEIALNGQDFSSLVPSQCYMIPPPLI
AGMEPGLISMNGGTTLTITGMNFVATGNIKVAFSLLNSGSASLDCVAIVNAKYRSNSVIT
CMTPSFIDRTDKRMIIYLYISLNGFDFDCIKLPRNSFPPGNLTQAHEPDVNQHESRQKRS
TSKTEKLPLSWDDGRYGRHRYTLDTQALDSNDLSHQENTLVESHSPILQQQLILYPRPEI
DMIQYVDGPDCLILRIIGRNFIDSASAIASFALVDNPKDQHSSSLQVKSETESECQIPES
VGHGILVFVKISFNGQEYISYEKPLIAQHRTRIFRLIPSWISLKSLMRSEESDAEKVCLK
LPGINMLPPKPSLEANNALVSFQMEKQIFFSAAMISDNEVQCLIPNDVIQSADTAFQHAI
TESMEDKASFVISILVDFSPNGRSFIGKPLIFSIHKEPPLLSSITPSNGPIFGGSTLTID
GEGFINTGEMSIRFSLLHLVPSADPEEKKEDRRNLPTSPRETCFGMRRVTSLTTATTRIL
SPKKQQVGNRETTSEVAKQNDSESTKKKTPSSTKKTDTVSFPARFISSTCITCTTSSFLS
EGIYQVSVTLNNLEYSEVNNSTKFLVWQSWQRKRQMLAGVIASDTSSTLISRLRADAQRD
QTLEPLPHDDSTPTKPEQNKNNDIISHEKKLVGLLGEVLALCDDDLLALSNAENNENSAE
YVSPAIHQLTFTSLYFVRTQDSLVEVMRNFSVSSAMKLQCEKPPETSAAPCEDVMRESSE
PLENMHQVISRDVFLKVMQHHFPRSPKSAQDRLWLLIKQQQKQNTKEDDQLNLKKKKTVV
ARVHTSAESSQLERNEPGPASYDPSYSNVEIRQPSALIMPKAATNVIQSTSPPIESIDHE
NSVKFIKPRIPQIFISKRNHITSWCNPIPKPWNHRESDMILRRDNRSPAKVQASQMCISA
SSAKKVRCPERPLRSDQNSPRSNRGTIAGRIIVNKDADIIAQEKQKQTDYPKSEDAGSER
KDMGDTNHTVAKKRKTRPADTPFLQDIAPMYTRFLRR
Download sequence
Identical sequences F0W2V0
CCA15386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]