SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCA19104 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA19104
Domain Number 1 Region: 4961-5018
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 2 Region: 6023-6091
Classification Level Classification E-value
Superfamily E set domains 0.000000187
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.021
Further Details:      
 
Domain Number 3 Region: 2844-2921
Classification Level Classification E-value
Superfamily E set domains 0.000000382
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Domain Number 4 Region: 7148-7231
Classification Level Classification E-value
Superfamily E set domains 0.00000077
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Domain Number 5 Region: 3039-3123
Classification Level Classification E-value
Superfamily E set domains 0.000000802
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.06
Further Details:      
 
Domain Number 6 Region: 5937-6017
Classification Level Classification E-value
Superfamily E set domains 0.0000046
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.028
Further Details:      
 
Domain Number 7 Region: 1857-1928
Classification Level Classification E-value
Superfamily E set domains 0.00000649
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 8 Region: 1563-1652
Classification Level Classification E-value
Superfamily E set domains 0.000007
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.022
Further Details:      
 
Domain Number 9 Region: 7237-7296
Classification Level Classification E-value
Superfamily E set domains 0.0000117
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 10 Region: 3236-3302
Classification Level Classification E-value
Superfamily E set domains 0.0000128
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 11 Region: 1664-1737
Classification Level Classification E-value
Superfamily E set domains 0.000023
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 
Domain Number 12 Region: 1043-1108
Classification Level Classification E-value
Superfamily E set domains 0.000089
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Weak hits

Sequence:  CCA19104
Domain Number - Region: 2744-2826
Classification Level Classification E-value
Superfamily E set domains 0.000252
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.036
Further Details:      
 
Domain Number - Region: 7048-7106
Classification Level Classification E-value
Superfamily E set domains 0.000392
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 2945-3022
Classification Level Classification E-value
Superfamily E set domains 0.000513
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number - Region: 554-641
Classification Level Classification E-value
Superfamily E set domains 0.00106
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 454-511
Classification Level Classification E-value
Superfamily E set domains 0.00336
Family E-set domains of sugar-utilizing enzymes 0.072
Further Details:      
 
Domain Number - Region: 5826-5890
Classification Level Classification E-value
Superfamily E set domains 0.00378
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number - Region: 2346-2403
Classification Level Classification E-value
Superfamily E set domains 0.00853
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.038
Further Details:      
 
Domain Number - Region: 856-923
Classification Level Classification E-value
Superfamily E set domains 0.00952
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.077
Further Details:      
 
Domain Number - Region: 7360-7419
Classification Level Classification E-value
Superfamily E set domains 0.0249
Family Other IPT/TIG domains 0.063
Further Details:      
 
Domain Number - Region: 972-1030
Classification Level Classification E-value
Superfamily E set domains 0.0322
Family E-set domains of sugar-utilizing enzymes 0.069
Further Details:      
 
Domain Number - Region: 5060-5121
Classification Level Classification E-value
Superfamily E set domains 0.084
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 
Domain Number - Region: 2641-2740
Classification Level Classification E-value
Superfamily E set domains 0.0965
Family Other IPT/TIG domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CCA19104
Sequence length 7494
Comment pep:novel supercontig:ENA1:FR824108:70413:93229:-1 gene:ALNC14_052470 transcript:CCA19104 description:"conserved hypothetical protein"
Sequence
MSTNVMVQFIEGDHPLPGTLKVECYFDNIRSEGTITRPNRYMCPSPILKIKKCTLLTIIV
NKQILAIPSNMSAFCVSPHSPVDSPGSRITNKTNSGITKHSSKTTPPNVCFMFASDSGFV
FADTRTMEKEVYCFSTAMVPLPSDGLVQFSSQTMTIQYPMQSNSSNRGSDRGILPYRYYR
ERQFDCCSTDRSENSMPMAHDDENISSGIFGHASSDVKPLQLGSATKKHILGYYHCFQTS
DCLLQPVKTALNSSSTSRGCRRTREKILECISIVVHGSKDSVTVQRGISRCSYGTAFITN
QPSRIAYYKSAAQIHGLVYHIFIVSLDSLISVQYASMMKKAINSDYVSHSRVLGTHTKSS
IVEQLLHPQCVYRQSSLIVAISGDNFMAAPHLRCIYDSGHFAIPALVHSNSIAQCTIPWE
YLKSRRRDERLRFRLADTFQFYPWHFIHKETPKLLRISPTLAPYGETIIIKLWGQQFADS
NYSVCLLGGMLVVAASYIQSDRVECIITSLQLQHFSSMINGSILILSVQYSGNGIDISEG
LHKLQLYPRPRYMELYPKSGSINGGTTLTFTMHGLQLNLDLDLILCRIGSKLVKGELIST
PRGNADLKIRCVSPKVRMAMHVQALITFNGQHFHNGPLFWYFEEFVILSSIVTTDRSVLT
GGYRSQLTNQLHLTGISFPRLPTSSCLFGNLKIRSQALWDSESHVRCEIPPDKCSRDASE
SVRVYFSANGVDFSETEYKFKTRNQLGSTIEQQVNSTSSFSPKLGSAKGGTSIKILVKNS
FPVACPYWECHFHMVKHDFLAESYVEASSTLTAEFREFLVCLTPYSFQTGPIGVTLRCSL
HNYEVPLQSPFYYIEEPRIRSIFPAIIHRNVLTNVRIQGENFLPISFCRFDKTIMVVALY
LNATLIQCDLIWYNVSTGSRYITVEVSVNEADFYSSDQSLEIAQSIIIDEVKPDLFFFQN
KANETARVSQTHVFGTGFIDSGRIVCRIGECAIFPGTYLSTTEIICGVPQITFATRLSLV
VSINGKDFFSYPHVAISFQRAPEIHAVNPRIGSFSGGDIVRVSGKHFVSTTKLIASCRFS
THDRKVFSSIATYVSSTLLACVTPPLKFIDVEAIQMRLDVAFEYYYDDAYGEQIALLASD
GFFIFYNISYNVTISPKILLNQAHEASLNDLDPSRSDGSIFVEGIFSLRNITVSCSIYDE
YMNERARLPLKTYQEEDILLEQHYFNRPSLEPGVYSLAFFIEKDKKLARIHSNPIRMFVA
EQLVINEVENLSGPTRGGTITVIHLRSSARQESSVVGICCRYDQVTSAAALDTTDSSLQC
TSPAWKVPKLVNLTFEYSIDGICQAQTLDYDKAPILFRYTSNEVIRDVTLRNSRFGDTFG
VDIHGSGFYKYSSRKAKCKLGDWLLLGANILSETKIECAWARLADLYQGKRHSISVACDG
QNFLRADKVLHTSQDMIIHRVSPSLITSDSIGTHIKIFGDGFPAYKSPIKCRFMSTNSTS
AFIITESSGLALTEHTAICNVPRLPEYGALNLQLAVCDLSDDIVFRFSNNAKLMGIPTLQ
KISVCPSSAFASGGTAIQVSVESFDTGSPFGMTVQKDTRYWCFFGENKVAEAYIESNNRL
RCITPKHEAHFTQFSVMDSKFYPIGQSVKFEFVPDAYIKKTSVLVGSARGGTDILLQLTR
LHISNEEKCLRIRCWFGSRPVTGTLVSDTQVICKSPAGIPASKVPFSLKINQITIPSTTG
LPLIFSYFSSKMLLSLEPNSGESRGGTSLRLGLEHAAFGMNQVESFDCAFTSQSDVTWTI
LTSAEVLHDTSRSFLILTCTSPPKPFSLQIRALINVAVFMNKERYSENSLSFRYMRKPTI
SHFTPELVPQQANEIVRLYGSNFIGDYSCQFGKYRSVETKMITPKLIECAVPLMPPEATS
VSIYHHGHEIAAASNKLQVIPNALPLQLYLSNHSLDYDDLTISGFEFSSSRYWACRNTIT
YQEADGVTSTKHRESSLFTYGWRNITFRLPHHLFKCKSGCSRVILHRVEILLHTKLFSAF
DVNVSLERRIALKLKSIEPSSGSVYGGTNLRMHLDVLLYERDTFLCDFGGALQVGKRVIE
SFISCNTPALSTLPNATSNEITVRVIIKSSQNNFELSSSGHIFTYYEDPVLSTIQLASSF
TQAKVYPVVILAKGSGFQNTSALFCRIGNQVLAIARFLSSNTMRCELDAKQSHRLNTELW
FIGFVHVEITLNGIDFTAQQLTLKLDDFVQDFEVSPLVATKSGRIPLLLTCNSCVSKTIS
FASECVFSSSSIKTFQWQEPIVRLNETHHMCMAPTVPFGIEYIRLGLGVDPNRVLKTIKI
IPDLKLRSIKPTCGPTFGGTKLVLDALYDRNDESIECIFGNGYEVKAIKSKTGSTLHCVV
PTNPKFDQINAEVKELSIQIRSHASILSNAIHFTGYTQPSIHHIHAILVPSTNGSDFFAL
WVYGSDFKKSSSLLGLIEHGSSGKPNRSQTTQSVGIKSTYINESCLYSELYNPWIVLEST
IAISNNAQDYANMIGKTKFPDSMLYTEDFYINPKIGSMRGGTPIHILPDKFMDRVVSQST
LHIFCQVGDVEIPVKQPRLCVSDAATRPSTHSFAIVIYSNDMRKKLLIRPKRNVTFTFVK
HPVLLSLHPNHGSSARKTELYLKGLNLGTSDNNVQIYLRSMDKAVNQIVAVAIPKIVTPT
YVRVSIPKLGAELSTHTKLVSVSLSINAGADVSNHLVFLYDACPVVDSLMPLRFLRVLSN
DSKTQSLLEIRGRNFSPYASNSSACKFGESHTVAPAKWISSTLITCFVPLHRLADGEHSV
QISLDNDDIMGSGAKIEIFSTFHITKLYPLFGQIEGKTIVYLSSNDFDRVDLLQNTFLSC
AFGRRLAPLRYVNQSTLKCVSPPGEFLSRVPFGVIQDGVALGTNSIAQRGYSTQDRDFYY
VRNLMISSIAPQKAYFGNLNSLIIRGENFLNTQWLSCRLHGINTPAVFISSTRIKCDLGL
LNKIVKARNFLSVNVQASNNGVEYSTKTKTLLLYQPFVITHISPTSCHLHEAVTVTIYGN
FFLEDHSFKCMIGESNTAPAIFRSSHHIECKFPTEVHAKTVFVAIAGNDIDYTVSSTPLR
FTYRDVITVQSYHPTTGPRIGGTSVNLIIVRPYGSIEGGTRIQVNLEFCSESYLMEDIRC
RFRSTNVGEVIVLGSWTSCVVYCVSPMLEPRTYQFDISLNGGMDYTSGKVLFHALSTPSL
LSILPRYGSIHGENYVKIIGTGFKADAVSDLVCSFNGEKSIGILRKENEIECKVPPLYSQ
ASSISEMQQIRFEVPKAKTEMQNIYLPNVPYQPEIQIISTKTWAASDQILQVKFTNYESL
DHEMIHIRTLSGDYEPAVQRIEFIYTAELPEVQRISVQAGNDFGGRFQIVVFNGITEWLP
YNVDHLMLSQALSKAVLGSQEFEVSPASTGDGKSHYWLVTFKSTLGPVSLLSVKTEGLQG
SQMNCMVDRARPGSVAEIQIVSIHGSRLDNILTGSFAVIGSSNSVLIKVHSDADAMATAL
IGLRGVKRPSVRFYHENTVLSNHEIKTTYFWEIKFARNPAMQTLLQVDTSMLKGVGGNVI
RTRNATSNLPHGFFTLTTGGETTTELPYNVSAYDLQSSLQSLTQSKSALVREVDSPDSLR
TLLINFPEAYYDVPLIQAKYKPSKPTGNHTDLKSDLSPGLDIFVSMVGMPRPLKGNMLLR
HPLTNEFKAVSVNADCSTLQSWLGSADCTMKGPGLNGDRDWYIHFPVGFVSSHRFTASSS
AMLGINPQVEVQHYAIDNRPEVQRINLTLSHIPSIQRIVITQRRLVWEAQMLEFQVPLQD
GTHHILTFRGRTSKPFLPNAPPAKLHQVLNSLLRSFYFEDSETSSAGNFADIVVSMNESN
SSTYSSHRWDITFYIGGDLPIIGIKKLPAIGLVGHGPISIADSFERRKGLVSEIQNITLL
CSPGLSGSFQIGFEGALTDRISFNANARTVASALSNLTALDEVNVTLISRNAKNMRTWKI
TFPFNLGDLEDLQIINVVSERILPLPTIRVAEHRKGNLSLLRGSFRIGISDRFTNLIPIT
ASAEAIREALHGLDLIADITVSYAGSDFSGGRSWVVTYRLNNPDDVLQLDTRQIVNSDYA
YGSVIHVKTQTQMEVQRIETRTHFGGVLSGHFFLRFAEDETTFLLPYDSSPELIAESLNA
LPSVGKVKVSRTNGILGSTSFIWLVTFTHPKRYANAPMLSAGGAQTTLVSTQSDASINIT
EIINGTLLPISGRFSLILNEEEVTVDTRATESELAALIGGLSAVDGYHVNLTSLNSDVFK
SLSWMVTFTNSGDLPELKIKLKDTNSNGGIIATVETLQDGTRKCCTASSSQVQLSHGPTN
VSLPGFITVEQNWPIIVTTENITGIVERGDVIRIGPLNFQVDLFLPMGPFMIPLNVPYPA
HSQSYIKAYIQMKTRPISIVSATEGEIRDSLESILSFRAISSVFVGQDQNGSSHVWQMAS
TSVQDLRVSSPYATTKHYMIRTQSIKSPEQAQVCMIYANGSSTIEGNFSISADKGKTYRS
LPWNATADMMKNLLESPGFYGSVLVSRMRLDQSPFPFGDGYGWLITLESERGMERPLTFS
TQNLRSIYRKDVEAGCILIRKSNFTMVKDEFLLIHNKRKVIVSHNATNLEMKEAFRSLGE
VVQVQRHENDHHDGFSWAITFLDDQMTAKSRPLIQIEINHRPGLKTGGAVRRARYPLASL
QSFKVGIGREFTHDLSRNITAAEVQEVMKALSFGHGIKIHDSSAGQKFERNWTVEFSSNY
GKLNLLTIKSRQHSKSEVNAYVSRLQEGYAHTPRRRVKITYGHSSLSVLNLSSKEDEIAA
AIEKLVNGTFRVRNVSIGIVDLQTSFQIVWDITFDTLSLDSGNCIKPLLNASFLHIGGPT
DPSFRIKSFRLQTGCVGVKVLYNGQDSAKNQLTYQYVRSPTVSHIQPNIGPTKGGSRIIL
RGEWFTLGPRLECVFGDTTSSAVFINATAVACVSPPSPTIRSVYIALRMYLGGQSADAGL
ESDRTAIFTYYHEIVLRSFISPDSGPNHGGSAVILHGTNFINSSMLSCSWSIDTPVRKYA
ATIIDRGVLLTSDSVICKAPSILAHWCNHTCSNAELYRARGRASLGISNNNKDFVSTQKS
ARFNYYPEIRLRSLDPQTGPFAGGTATVVHYYSTEKTLRITHCQFGYKRLGIFVVPAQQH
SSTSVRCDTPPSALRPTTFEIIIAASVPRPEIQVISTHLESRGSSLSGYFSLGVPNTAQT
DVLWSRYIAFDAPAIDETQHSVYSILSEILPVMSVTRSGPNNQYCYSWSVTFQPTAGDIE
MLISNNQLLISDDERAEVYVHTLQDGAIRPIRNEIQSIKLVQIGLSNPVVSIQIPHGERV
LEVQRITVSSQYPIQGHFALAYGLNIIVIRSTVSSLELRDILESALSVLIINVSRSHVPN
YYGFYWDVTFDLDAKERKLLSISDHNLTSMSGVSKTVMCLSEASVSLSGNITLGLTTNAS
RQAKISVDASTDDLYKAVYVSLGLRPIKVSKITSPKLVWNITFSVLDGSGDRIYLHEAAV
HGINSKVEIIHDTSGGNRMAGTFRVKTLLSDHQSLPITYVNSTHAGVLDALRSLRLSSTL
PEKGIKNVRQISIENGTEWRVEFSDVLANVPLLELDASQMVGHGITAFVDTLQEGEEALL
AGLFRVQTNSGLTNMIPADDDGKALRRELQNLFDVKLMEVNRSSYHDAESRNGSRWMIKS
ESAISNSALRSLQILDTNLIGISTFTATNIIDEGADSIVEVRLSYNDAQYFSLESLPFRY
VIPPQVLHATPMRGPMTGLTRIVITLAKQPTSVSATKASESIFKCKFGDLVTEAELVSES
LLICTSPTIGTASSESYESLLTEFTKPVYISSNGVDFDTHAGDFVYTTDGLYNRMQLSPS
HGTVEGGTLVYMSHFEYNPNISHQCQFGESLFIRQEIGNASHVACRTPPVLTTGPVVVKL
SHGPDNTLIMSQSIFFYMEPLHVSSIDPNSGPVGGGQKVVIEGAEFFDTSGDEFHCRFGR
TSVEAKRLSPLSLSCITPPLVELQNIQEVHIQASSFLPQVMRIRIDADPSVPFVQQVRLR
SNTPRSPEIQRLMLYSTNRTTVQSITAQISREGSDGEITSIRTQAPPSIRNEIQAVTLWS
QAYIAGMFKLEMLGQKTIHLYSYSTSVDFENALEMLDTVGKVKVTKSTISTSTGSLTWEV
QFLEKRGYIPDLKVQNVSLQDSGTIDLQIEVVELMKGHSQPLSGGFKLNIDGTDSQMLPY
DASAEEFLLALEGVVFSLRGAQVLDRIKENLKGEIEWIVELPALPDRVRKIFPQVGNLCS
GSGRVLIDLISSGSKSEVQQVTTLLSGGYFRSGMGNGSSGPIPFDSDSDKFEQMMMSEGF
GEIDVAIANNPVGHSVWLIIFLSWPGDVPLVNCGQSQTVVEVRKGTGAAIRPVFRLGLKD
EWSSVYIPLDDNGHVIKASLNQLFRNSHVVKVEQVSELRAESGERTWQVEITSQVSAELA
LLRTESISFEEGSNEIRVLNVSRYGDALLECGDLEQIQLIPIDNDSSRLFNSSEALQNAT
KATVGTFRLHYGAKYTPDLPWNISAQEMMIAFKSFGLVAGNDVKVSRTFTHGPWQEVYWN
ITFPYASPALQLIPEIYSKPKESNIRISIDVLSTENVQLGGKFSLAFQNHQSSELHLWNV
TESELIFTLESLPSLGAVSVKKVDGDNWTELKISLWSLWINIHAQVSQSLLTPIALDGSS
VQGSHVNVSSWVESNGTHNEIQSVSICGVLAPPQISFTIVLNGTSATTQTSTTASAGEFK
SSVLTAYSGDLMVERIKCSVGFGYIWLVLFHEYLHNAPHISFRFAENEPLLAGLIVEVTT
YPATTVGLFGEFQLELTSCFDIAGRKASCRNARTSYILHNATSAMVKNHLATLPDLEDLS
VSGTIIAADLYHVWRLTYTPSLGQDISFSIIPGNLTGSNTTLGVVMTQKGLPSDGFLVSV
EVSSNMKDFTSSGVFYRYHPFIQVHRLTISHGPFQGGKNLILMGSSIPESSHLNCCFGNE
NEISVPAIYFNTTHVSCVSPRLFLDFTDDNDTRRVSIPVFISVNGITDVSRTDALDGAIF
TYEKPVTLSGIFPSSGSIDGEYMIDILGGPYFEDISDEIQCKFGDKTVSGIWLQPDKIEC
KAPKVSSAGSIFLKVTTNRHDFTPQGLTFVYYHTLMIKHIFPIMGPARRAGTSVMIHGQD
FVNASSLSCRFGFSLVSGAYVSPSKMICISPPISEQNKGLHSYSLENHRPGFYSSDIGRS
DLTLPKARNYPHYQLSGVSIEVSNNGLDFSQSGLEFIYYEDPNVTSIYPSQFYDVPQLSF
FIQGFNFVNVTTLVCRVGVQLFDAAFITPNLLLCTASNLRPIYGNPASSNRLRLLYARNV
YVKISVNGIDFTSNFQAIDLLGPCPTGMYCPLNVNGKGIKCHKGAYCPGEGSSN
Download sequence
Identical sequences F0WD32
CCA19104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]