SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCA27125 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA27125
Domain Number 1 Region: 75-109
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000279
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  CCA27125
Domain Number - Region: 18-51
Classification Level Classification E-value
Superfamily ClpS-like 0.0575
Family Ribosomal protein L7/12, C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CCA27125
Sequence length 110
Comment pep:novel supercontig:ENA1:FR824501:8559:8891:1 gene:ALNC14_132690 transcript:CCA27125 description:""
Sequence
MPVNEAIGASIEFNEQLVVLLGSMSENIDQIIKIMENVTGMDMVQAKEMLLRESESISGK
EKKHGMALKAQYKRQSKDRANRTSRNTAEFEGKCFRCNKYGHKQADCRKK
Download sequence
Identical sequences F0X043
CCA27125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]