SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|469817796|ref|YP_007589880.1| from Rhodanobacter denitrificans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|469817796|ref|YP_007589880.1|
Domain Number 1 Region: 135-335
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.19e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000116
Further Details:      
 
Domain Number 2 Region: 421-550
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000966
Further Details:      
 
Domain Number 3 Region: 4-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.5e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.001
Further Details:      
 
Domain Number 4 Region: 337-413
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.59e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|469817796|ref|YP_007589880.1|
Sequence length 565
Comment sulfite reductase (NADPH) hemoprotein, beta-component [Rhodanobacter denitrificans]
Sequence
MTSHLEHIKAASRHLRGTIAEGLADPITGAIGEDDTKLLKFHGSYQQDDRDLREERRRQK
LEPAYSFMLRARLPGGVVTPAQWLVFDRIAREHASGTLRITTRQTFQWHGIIKRRLKPTI
AAIHQALATTIAACGDVVRNVVSTANPVESAAHAEAYAWATRLSAELAPKTHAYHEIWLD
GEQLHGDARPVEEHEPLYGATYLPRKFKIGLAIPPLNDIDVFAQDLGLIAIAEQGVLRGF
NIAVGGGMGATHGDATTYPRLASVIGFVTPEQLFGVAEAAIGVQRDWGGRDERKHARLKY
TLDRHGVDAFKAELESRLGYALAAPRAYRFAHNGDRYGWVEGGDGRWHLTLHIESGRLAD
TGERRWLTGLRELAKAHAGDFRLTCNQNVIVANVAAGERERIDAIVREHGLDGYRRQSAI
RRHAIACVALPTCGLAMAESERYLPALLPKLEARLDHHGLADAPILLRLSGCPNGCSRPY
LGEIALVGRGPGRYDLRLGADFSGQRLNQVYRENVDEAAILAALDPLFARYAAEREDGEG
FGDFLLRAGVLAPLPSRRIPAELVA
Download sequence
Identical sequences M4ND42
WP_015447436.1.60129 gi|469817796|ref|YP_007589880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]