SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|469818454|ref|YP_007590538.1| from Rhodanobacter denitrificans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|469818454|ref|YP_007590538.1|
Domain Number 1 Region: 231-275,308-557
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-36
Family CoA transferase alpha subunit-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|469818454|ref|YP_007590538.1|
Sequence length 651
Comment hypothetical protein R2APBS1_2191 [Rhodanobacter denitrificans]
Sequence
MIARMSIEHRYADTDACARDLADGLGPHLRIAAPLGLGKPHGLLNALYRLVAADAGRSMR
LYTALSLTRPQPTPGLEQRFLGPFLERHFGADAVDPHYALDQARDALPANVEVHEFYLQS
GALLRSASAQRSYISQNYTHVARDLALQDINLLVQLVARREGPDGVHYSLSCNPDLTLDL
LRRLQSSGRPRPLCVAVVHPELPYLGGDAEVAEAYFDVELRPPTSPPLFALPRSPVGLAE
YALGLHASALVRDGGCLQIGIGALSDALVKALLLRQHDNTRWRQALAALDPAGATRVLAE
QQGGLAPFEAGLYGASEMVMDGFMHLQRGGILKRRSWDNLALERAAAAGRLNPATPGGHY
LRGAFFLGSRELYAWLAATEAADPDAIDMCAVSNVNQLYGDHQALAMLQRRGARFFNTCM
MATVLGAAVSDTLEDGAVVSGVGGQYNFVAMAHELPDARSALLLRATREGRGGIESNIRW
NYGQTTIARHLRDIVVTEYGIADLRGKSDGECVEAMLSIADARFLDALCAQAKAHGKLAA
DFAVPEAWRRHRPEHLHEALAPLRHEGVLPAFPFGSDFTEVEQRLLPALEWLKACSGHWR
GRWRLLGAVIRPGDVVDGESEALARMGLDTPASWPGRVQRRLLQTALRRQR
Download sequence
Identical sequences M4NI05
gi|469818454|ref|YP_007590538.1| WP_015447963.1.60129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]