SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000085068 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000085068
Domain Number 1 Region: 11-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 2.09e-44
Family Isochorismatase-like hydrolases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000085068   Gene: ENSG00000063241   Transcript: ENST00000085068
Sequence length 221
Comment pep:known chromosome:GRCh38:19:55452989:55461645:-1 gene:ENSG00000063241 transcript:ENST00000085068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQ
YPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILDPRS
YPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGL
ILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH
Download sequence
Identical sequences ENSP00000085068 ENSP00000085068 9606.ENSP00000085068 NP_078986.1.87134 NP_078986.1.92137 gi|13376007|ref|NP_078986.1| ENSP00000085068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]