SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000199708 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000199708
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 5.92e-44
Family Globins 0.00000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000199708   Gene: ENSG00000086506   Transcript: ENST00000199708
Sequence length 142
Comment pep:known chromosome:GRCh38:16:180453:181181:1 gene:ENSG00000086506 transcript:ENST00000199708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALVSEYR
Download sequence
Identical sequences A0A1K0GUV5 A0A2I3SN30 P09105
ENSP00000199708 NP_005322.1.87134 NP_005322.1.92137 XP_003809437.1.60992 XP_016784464.1.37143 ENSP00000199708 gi|4885395|ref|NP_005322.1| ENSP00000199708 9606.ENSP00000199708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]