SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000211122 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000211122
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.33e-42
Family Glutathione S-transferase (GST), C-terminal domain 0.000043
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-32
Family SCOPe 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000211122   Gene: ENSG00000174156   Transcript: ENST00000211122
Sequence length 222
Comment pep:known chromosome:GRCh38:6:52896639:52909685:-1 gene:ENSG00000174156 transcript:ENST00000211122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Download sequence
Identical sequences Q16772
1tdi_A 1tdi_B 2vcv_A 2vcv_B 2vcv_C 2vcv_D 2vcv_E 2vcv_F 2vcv_G 2vcv_H 2vcv_I 2vcv_J 2vcv_K 2vcv_L 2vcv_M 2vcv_N 2vcv_O 2vcv_P gi|24430144|ref|NP_000838.3| ENSP00000211122 ENSP00000360007 9606.ENSP00000211122 NP_000838.3.87134 NP_000838.3.92137 ENSP00000211122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]