SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000215587 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000215587
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 2.88e-45
Family Eukaryotic RPB5 N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 135-189
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 5.62e-19
Family RPB5 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000215587   Gene: ENSG00000099817   Transcript: ENST00000215587
Sequence length 204
Comment pep:known chromosome:GRCh38:19:1088163:1095374:-1 gene:ENSG00000099817 transcript:ENST00000215587 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQPLLSVSAGGEDHPAQ
Download sequence
Identical sequences A0A0A0MQR7
ENSP00000215587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]