SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000215912 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000215912
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000215912   Gene: ENSG00000100100   Transcript: ENST00000215912
Sequence length 263
Comment pep:known chromosome:GRCh38:22:31281593:31292528:-1 gene:ENSG00000100100 transcript:ENST00000215912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGTTPLMGQAGTPGA
Download sequence
Identical sequences A0A024R1M3 Q96FE7
9606.ENSP00000215912 NP_443112.2.87134 NP_443112.2.92137 ENSP00000215912 ENSP00000215912 gi|51317358|ref|NP_443112.2| ENSP00000215912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]