SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000219070 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000219070
Domain Number 1 Region: 462-660
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.15e-68
Family Hemopexin-like domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 88-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.82e-38
Family Matrix metalloproteases, catalytic domain 0.000000305
Further Details:      
 
Domain Number 3 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 2.06e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000219070   Gene: ENSG00000087245   Transcript: ENST00000219070
Sequence length 660
Comment pep:known chromosome:GRCh38:16:55478971:55506691:1 gene:ENSG00000087245 transcript:ENST00000219070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences A0A024R6R4 P08253
ENSP00000219070 NP_004521.1.87134 NP_004521.1.92137 XP_004057705.2.27298 9606.ENSP00000219070 ENSP00000219070 ENSP00000219070 gi|11342666|ref|NP_004521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]