SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000226218 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000226218
Domain Number 1 Region: 149-296,335-350,430-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.2e-54
Family Hemopexin-like domain 0.00055
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000183
Family Somatomedin B domain 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000226218   Gene: ENSG00000109072   Transcript: ENST00000226218
Sequence length 478
Comment pep:known chromosome:GRCh38:17:28367276:28370822:-1 gene:ENSG00000109072 transcript:ENST00000226218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Download sequence
Identical sequences D9ZGG2 P04004
NP_000629.3.87134 NP_000629.3.92137 ENSP00000226218 ENSP00000459404 9606.ENSP00000226218 ENSP00000226218 ENSP00000226218 ENSP00000459404 gi|88853069|ref|NP_000629.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]