SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000232744 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000232744
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily POZ domain 3.49e-24
Family BTB/POZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 271-374
Classification Level Classification E-value
Superfamily POZ domain 1.13e-23
Family BTB/POZ domain 0.021
Further Details:      
 
Domain Number 3 Region: 5-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000466
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000232744   Gene: ENSG00000114626   Transcript: ENST00000232744
Sequence length 478
Comment pep:known chromosome:GRCh38:3:127672940:127680917:1 gene:ENSG00000114626 transcript:ENST00000232744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRVHRCVLGARSAYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRED
MALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRSDYFRAL
LDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYL
LPGLKRLCGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
Download sequence
Identical sequences Q969K4
9606.ENSP00000232744 ENSP00000232744 ENSP00000377030 NP_742024.1.87134 NP_742024.1.92137 HR6093 ENSP00000232744 gi|25777624|ref|NP_742024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]