SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000232974 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000232974
Domain Number 1 Region: 613-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily POZ domain 1.05e-20
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 3 Region: 529-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000989
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 458-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000208
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 575-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000895
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000232974   Gene: ENSG00000114853   Transcript: ENST00000232974
Sequence length 747
Comment pep:known chromosome:GRCh38:3:42653684:42665854:1 gene:ENSG00000114853 transcript:ENST00000232974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNEQRLFQPDLCDVDLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLE
ALAPGGLQQILNFIYTSKLLVNAANVHEVLSAASLLQMADIAASCQELLDARSLGPPGPG
TVALAQPAASCTPAAPPYYCDIKQEADTPGLPKIYAREGPDPYSVRVEDGAGTAGGTVPA
TIGPAQPFFKEEKEGGVEEAGGPPASLCKLEGGEELEEELGGSGTYSRREQSQIIVEVNL
NNQTLHVSTGPEGKPGAGPSPATVVLGREDGLQRHSDEEEEDDEEEEEEEEEEEGGGSGR
EEEEEEEGGSQGEEEEEEEDGHSEQEEEEEEEEEEGPSEQDQESSEEEEGEEGEAGGKQG
PRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARGPPA
TDGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICDQCGKRFLLESELLL
HRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMAHVRKHMV
AHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCNERFQYKYQLRSHMSIHIG
HKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRPNMKRHRRTHTGEKPY
PCDVCGQRFRFSNMLKAHKEKCFRVSHTLAGDGVPAAPGLPPTQPQAHALPLLPGLPQTL
PPPPHLPPPPPLFPTTASPGGRMNANN
Download sequence
Identical sequences Q9UFB7
ENSP00000232974 ENSP00000232974 NP_660149.2.87134 NP_660149.2.92137 gi|262263347|ref|NP_660149.2| ENSP00000232974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]