SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000233092 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000233092
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-25
Family FKBP immunophilin/proline isomerase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000233092   Gene: ENSG00000079150   Transcript: ENST00000233092
Sequence length 127
Comment pep:known chromosome:GRCh38:2:178465599:178478575:-1 gene:ENSG00000079150 transcript:ENST00000233092 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYGST
Download sequence
Identical sequences A0A2J8PRG1 F8WE12 G3SKE3
ENSP00000233092 ENSP00000233092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]