SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000234111 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000234111
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.53e-72
Family Alanine racemase-like, N-terminal domain 0.000000000422
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.78e-49
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000234111   Gene: ENSG00000115758   Transcript: ENST00000234111
Sequence length 461
Comment pep:known chromosome:GRCh38:2:10439968:10448504:-1 gene:ENSG00000115758 transcript:ENST00000234111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV
Download sequence
Identical sequences P11926
ENSP00000234111 2on3_A 2on3_B 5bwa_A ENSP00000234111 ENSP00000385333 9606.ENSP00000234111 gi|4505489|ref|NP_002530.1| ENSP00000234111 ENSP00000385333 NP_001274118.1.87134 NP_001274118.1.92137 NP_001274119.1.87134 NP_001274119.1.92137 NP_002530.1.87134 NP_002530.1.92137 Hs4505489___KOG0622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]