SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000236017 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000236017
Domain Number - Region: 65-116
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00196
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000236017   Gene: ENSG00000117362   Transcript: ENST00000236017
Sequence length 150
Comment pep:novel chromosome:GRCh38:1:150266645:150269023:-1 gene:ENSG00000117362 transcript:ENST00000236017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGKADEGLASLSEDGRSPISIRQM
AYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVV
FFDACERRRYWALGLVVGSHLLTSGLTFLN
Download sequence
Identical sequences A0A2J8JJ06 A0A2J8VEK9 F7FDJ2 Q5TB21
ENSP00000236017 ENSP00000236017 ENSP00000462671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]