SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000244303 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000244303
Domain Number 1 Region: 172-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.39e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Weak hits

Sequence:  ENSP00000244303
Domain Number - Region: 50-86
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000165
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000244303   Gene: ENSG00000124440   Transcript: ENST00000244303
Sequence length 600
Comment pep:known chromosome:GRCh38:19:46298390:46339909:1 gene:ENSG00000124440 transcript:ENST00000244303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAGAARRPRCCTSWLTRCPSPAASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVL
NCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDM
KFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLAR
SGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQTEQHSRRPIQRGAP
SQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPILDGASVAA
TPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEM
LAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRL
SCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLS
LSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD
Download sequence
Identical sequences NP_071907.4.87134 NP_071907.4.92137 ENSP00000244303 gi|326807022|ref|NP_071907.4| ENSP00000244303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]