SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000244364 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000244364
Domain Number 1 Region: 4130-4289
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 2 Region: 3960-4073
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 4371-4506
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 3471-3630
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 3712-3852
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 2928-3085
Classification Level Classification E-value
Superfamily Spectrin repeat 4.52e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2159-2315
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-23
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 8 Region: 4502-4617
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 1691-1849
Classification Level Classification E-value
Superfamily Spectrin repeat 8e-21
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 10 Region: 4864-4946
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.09e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 11 Region: 2492-2646
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 4292-4401
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-20
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 13 Region: 3364-3511
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 14 Region: 3849-3963
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-18
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 15 Region: 2705-2865
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 16 Region: 3080-3197
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-16
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 17 Region: 910-1038,1065-1093
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 18 Region: 375-477
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 19 Region: 4775-4855
Classification Level Classification E-value
Superfamily EF-hand 6.99e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 20 Region: 2380-2502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000091
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 21 Region: 3146-3297
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000173
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 22 Region: 3628-3741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 23 Region: 1462-1583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 24 Region: 4627-4699,4729-4758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000083
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 25 Region: 1599-1705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000755
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 26 Region: 1908-2028
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000109
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 2067-2176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000245
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 282-374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000366
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 29 Region: 466-557,678-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000317
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000244364
Domain Number - Region: 1229-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00141
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 695-845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00484
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000244364   Gene: ENSG00000151914   Transcript: ENST00000244364
Sequence length 5171
Comment pep:known chromosome:GRCh38:6:56457987:56642996:-1 gene:ENSG00000151914 transcript:ENST00000244364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEML
QQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVI
DVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSL
NSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPN
FSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTE
WGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAK
LLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMR
ELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTA
YFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIAN
LMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVIS
PTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEI
DRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQ
YYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRI
TEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSST
YIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKR
QVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLE
GIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQS
KMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTR
YTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKA
GKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYN
LLFSESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMI
GDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNE
AKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKD
SERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQK
VKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESE
KKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSED
VISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKC
NVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKAL
QGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKL
QITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQS
SINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFE
NLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISS
HGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETT
KKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAI
AAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKL
SKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKV
QELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQT
VEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGI
LSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKL
SDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYL
KAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKS
HPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTI
KTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGEN
SIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHS
KKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQ
ALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQG
IGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNAN
KTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKE
FSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQS
AAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTE
ELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKIL
KQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT
QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYI
EIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSE
LRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAK
TLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNN
KALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQ
FDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSG
HKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPW
LTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEG
FSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPP
SISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKL
DQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPS
VVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLN
KAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQ
FKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKL
EGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQS
TVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFH
GEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQ
MLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLT
QAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVV
LIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELE
IANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELR
DKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMN
LIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSIS
KQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRTLIDQHKEFMKKL
EEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAG
LIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDK
VTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKW
QQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKD
QDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPI
TDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVR
VGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGAS
PNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYGKPWLTNSKMSTPCKAAECSDFPVP
SAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSK
AGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKS
PASKLDKSSKR
Download sequence
Identical sequences ENSP00000244364 gi|34577049|ref|NP_056363.2| NP_056363.2.87134 NP_056363.2.92137 ENSP00000244364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]