SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000245539 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000245539
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.56e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000245539   Gene: ENSG00000125445   Transcript: ENST00000245539
Sequence length 242
Comment pep:known chromosome:GRCh38:17:75261674:75266373:1 gene:ENSG00000125445 transcript:ENST00000245539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRR
FLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYR
WW
Download sequence
Identical sequences A0A024R8L0 Q9Y2R9
3j9m_AF 9606.ENSP00000245539 gi|186928852|ref|NP_057055.2| ENSP00000245539 ENSP00000245539 NP_057055.2.87134 NP_057055.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]