SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000246186 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000246186
Domain Number 1 Region: 373-569
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.41e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 161-327
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-56
Family Matrix metalloproteases, catalytic domain 0.000000114
Further Details:      
 
Domain Number 3 Region: 72-144
Classification Level Classification E-value
Superfamily PGBD-like 1.35e-19
Family MMP N-terminal domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSP00000246186
Domain Number - Region: 11-20
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000246186   Gene: ENSG00000125966   Transcript: ENST00000246186
Sequence length 645
Comment pep:known chromosome:GRCh38:20:35226654:35277000:1 gene:ENSG00000125966 transcript:ENST00000246186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Download sequence
Identical sequences H2QK91 Q9Y5R2
ENSPTRP00000023039 9606.ENSP00000246186 ENSPTRP00000023039 ENSP00000246186 gi|5729929|ref|NP_006681.1| ENSP00000246186 NP_006681.1.87134 NP_006681.1.92137 XP_009435366.1.37143 ENSP00000246186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]