SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000250937 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000250937
Domain Number 1 Region: 52-277
Classification Level Classification E-value
Superfamily ARM repeat 5.08e-37
Family PBS lyase HEAT-like repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000250937   Gene: ENSG00000129932   Transcript: ENST00000250937
Sequence length 302
Comment pep:known chromosome:GRCh38:19:3490821:3500637:-1 gene:ENSG00000129932 transcript:ENST00000250937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAY
CLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAE
TCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMF
ALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRH
ECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQYADGLEQLRGA
PS
Download sequence
Identical sequences Q9BU89
ENSP00000250937 ENSP00000398882 ENSP00000250937 gi|13775228|ref|NP_112594.1| gi|223633884|ref|NP_001138637.1| NP_001138637.1.87134 NP_001138637.1.92137 NP_112594.1.87134 NP_112594.1.92137 Hs13775228___KOG0567 GO.36544 ENSP00000250937 ENSP00000398882 9606.ENSP00000250937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]