SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000251473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000251473
Domain Number 1 Region: 119-285
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0000000014
Family Type 2 phosphatidic acid phosphatase, PAP2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000251473   Gene: ENSG00000105520   Transcript: ENST00000251473
Sequence length 343
Comment pep:known chromosome:GRCh38:19:11355386:11365698:1 gene:ENSG00000105520 transcript:ENST00000251473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPY
PGPEAASRVPPALVYALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFS
PPVRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCLPPSPDRPG
PDRFVTDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSP
WEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT
Download sequence
Identical sequences A0A024R7E2 Q96GM1
gi|282400942|ref|NP_073574.2| ENSP00000251473 ENSGGOP00000002501 9606.ENSP00000251473 ENSGGOP00000002501 NP_073574.2.87134 NP_073574.2.92137 XP_003830538.1.60992 XP_004060071.1.27298 ENSP00000251473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]