SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000252037 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000252037
Domain Number 1 Region: 23-142
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-29
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 8.26e-22
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000252037   Gene: ENSG00000077800   Transcript: ENST00000252037
Sequence length 327
Comment pep:known chromosome:GRCh38:7:73328360:73358625:1 gene:ENSG00000077800 transcript:ENST00000252037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGT
LGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALC
YGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCY
RDYVDKEKEMWHRMFAPCGDGSTAGES
Download sequence
Identical sequences O75344
9606.ENSP00000252037 NP_003593.3.87134 NP_003593.3.92137 ENSP00000252037 ENSP00000416277 ENSP00000461242 gi|146229346|ref|NP_003593.3| ENSP00000252037 ENSP00000458784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]